Hp Storage Essentials Enterprise Edition Software Uživatelský manuál Strana 1

Procházejte online nebo si stáhněte Uživatelský manuál pro Úložný prostor Hp Storage Essentials Enterprise Edition Software. HP Storage Essentials Enterprise Edition Software User Manual Uživatelská příručka

  • Stažení
  • Přidat do mých příruček
  • Tisk
  • Strana
    / 798
  • Tabulka s obsahem
  • ŘEŠENÍ PROBLÉMŮ
  • KNIHY
  • Hodnocené. / 5. Na základě hodnocení zákazníků
Zobrazit stránku 0
HP Storage Essentials SRM 6.0 User Guide
for Enterprise Edition and Standard Edition SRM
Software
Second edition: July 2008
Zobrazit stránku 0
1 2 3 4 5 6 ... 797 798

Shrnutí obsahu

Strany 1 - Software

HP Storage Essentials SRM 6.0 User Guidefor Enterprise Edition and Standard Edition SRM SoftwareSecond edition: July 2008

Strany 2

xManaging Performance Collectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 217Starting Performance Collect

Strany 3 - Contents

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries62Discovering Sun StorEdge 3510 Storage SystemsBefore you can discover a Sun Sto

Strany 4

HP Storage Essentials SRM 6.0 User Guide 63• IP address or system name of the controller or proxy you want to discover. • HP SIM does not allow blank

Strany 5

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries64• Discovering HP NAS Devices on Linux, page 64• Discovering NetApp NAS Devices

Strany 6

HP Storage Essentials SRM 6.0 User Guide 656. Change the value to true to enable NAS support, as shown in the following example:nas=true7. Save your c

Strany 7

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries661. Select Options > Storage Essentials > Manage Product Health, and then

Strany 8

HP Storage Essentials SRM 6.0 User Guide 67Discovery Data CollectionIMPORTANT: Access Discovery Data Collection by selecting Options > Storage Esse

Strany 9

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries68• If an element changes and you run Discovery Data Collection while the provid

Strany 10

HP Storage Essentials SRM 6.0 User Guide 692. On the View Logs page, click the Click here portion of the following message:Click here if you wish to s

Strany 11

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries70NOTE: The sample file is located in <HP SIM install directory>/config o

Strany 12

HP Storage Essentials SRM 6.0 User Guide 71Rules for the Inclusive and Exclusive FlagsThe filter file uses inclusive or exclusive flags to indicate in

Strany 13

HP Storage Essentials SRM 6.0 User Guide xiGenerating a Support Database . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 14

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries721. Use a text editor to create a file named SEDiscoveryFilterList (with no fil

Strany 15

HP Storage Essentials SRM 6.0 User Guide 73To view HP Storage Essentials progress, open the HP Storage Essentials Log and click Refresh in the next tw

Strany 16

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries744. Select the Systems loaded from the central management server, sorted by opt

Strany 17

HP Storage Essentials SRM 6.0 User Guide 75During these operations, the management server displays its status at regular intervals. To view logs for t

Strany 18

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries76Using Discovery GroupsThe discovery groups feature is sometimes called segment

Strany 19

HP Storage Essentials SRM 6.0 User Guide 77Creating Custom Discovery ListsYou can create a discovery list for Discovery Data Collection, which will al

Strany 20

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries78NOTE: The path to the log file for the discovery group is listed at the top of

Strany 21

HP Storage Essentials SRM 6.0 User Guide 79Deleting Discovered ElementsTo remove a discovered element completely you must delete it from both HP SIM a

Strany 22

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries80If you are blocking pop-ups you must disable the popup blocker before you can

Strany 23

HP Storage Essentials SRM 6.0 User Guide 81The elements you quarantine appear with a flag ( ) in the Quarantined column on the Discovery Data Collecti

Strany 24

xiiChanging the Fabric Name . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 290Deleting Fabrics . . . . . .

Strany 25

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries82For more information, see the following topics: ”Excluding EMC Symmetrix Stora

Strany 26

HP Storage Essentials SRM 6.0 User Guide 833 Discovering Applications, Backup Hosts and HostsHP Storage Essentials Standard Edition supports a subset

Strany 27

Discovering Applications, Backup Hosts and Hosts84service. To determine the Logon account for the DataProtector CRS service, go to Control Panel >

Strany 28

HP Storage Essentials SRM 6.0 User Guide 85Discovery of hosts consists of these steps:• ”Step A — Set Up Discovery for Hosts” on page 85.• ”Step B — D

Strany 29

Discovering Applications, Backup Hosts and Hosts86NOTE: To use a hosts file to specify systems for an automatic discovery, add the hosts file name to

Strany 30

HP Storage Essentials SRM 6.0 User Guide 87NOTE: SE discovery processing might finish before the SE Identification column shows the Running status. Fr

Strany 31

Discovering Applications, Backup Hosts and Hosts88• During Discovery Data Collection the data you see in the user interface is not updated until the d

Strany 32

HP Storage Essentials SRM 6.0 User Guide 89See ”Step 1 — Discovering Your Hosts and Backup Manager Hosts” on page 83, then set up the configurations f

Strany 33

Discovering Applications, Backup Hosts and Hosts901. Select Discovery > Setup.2. Click the Applications tab.3. Click Change Password in the Change

Strany 34

HP Storage Essentials SRM 6.0 User Guide 91• Verify that the instance TNS (Transparent Name Substrate) listener is running so that the management serv

Strany 35 - About this Guide

HP Storage Essentials SRM 6.0 User Guide xiiiDetermining If a Host Belongs to a File System . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 36

Discovering Applications, Backup Hosts and Hosts92NOTE: You can use a remote Oracle client to run this script. 4. Specify the Oracle instance name, wh

Strany 37 - HP Technical Support

HP Storage Essentials SRM 6.0 User Guide 932. If you plan to remove the management software for Oracle from a computer running Windows, go to the \DBI

Strany 38

Discovering Applications, Backup Hosts and Hosts94IMPORTANT: Monitoring Oracle 10g or Oracle clusters requires an additional step. If you are not moni

Strany 39 - 1Overview

HP Storage Essentials SRM 6.0 User Guide 95The port can be found in the following code:LISTENER = (DESCRIPTION_LIST = (DESCRIPTION = (ADDRESS

Strany 40 - Overview2

Discovering Applications, Backup Hosts and Hosts961. Install the CIM extension on each node in the cluster.2. Create the APPIQ_USER account for the Or

Strany 41

HP Storage Essentials SRM 6.0 User Guide 97Discovery of Oracle RAC Instances Using One InstanceBecause one RAC instance can provide information for th

Strany 42 - Overview4

Discovering Applications, Backup Hosts and Hosts98b. Click the Create button for the Database Information table.c. In the Host IP/DNS Name box, enter

Strany 43

HP Storage Essentials SRM 6.0 User Guide 99return identical capacity data). However, the management server does not explicitly identify and construct

Strany 44 - Product Components

Discovering Applications, Backup Hosts and Hosts100of the monitored database. Do not look for the listener.ora file on the management server for this

Strany 45

HP Storage Essentials SRM 6.0 User Guide 101• ”Step B — Provide the Microsoft SQL Server Name and Port Number” on page 104IMPORTANT: Make sure the Mic

Strany 46 - The Top Pane

xivSeverity Levels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 373Creating a Uti

Strany 47 - The Left Pane

Discovering Applications, Backup Hosts and Hosts102The management server accesses Microsoft SQL Server through the appiq_user account. This account is

Strany 48 - Overview10

HP Storage Essentials SRM 6.0 User Guide 103criteria described in ”Creating Custom Passwords on Managed Database Instances” on page 88. If you are run

Strany 49 - The Home Page

Discovering Applications, Backup Hosts and Hosts104You are prompted for the password for this user account when you run the script.3. In a new command

Strany 50 - Overview12

HP Storage Essentials SRM 6.0 User Guide 105IMPORTANT: If you have name resolutions issues, your server may be discovered; however, your applications

Strany 51 - Installing the Java Plug-in

Discovering Applications, Backup Hosts and Hosts106Microsoft SQL Server 2000a. Open SQL Server Enterprise Manager. b. Expand the user interface for SQ

Strany 52 - Overview14

HP Storage Essentials SRM 6.0 User Guide 107The account for appiq_user is removed. The management server can no longer monitor the SQL Server database

Strany 53

Discovering Applications, Backup Hosts and Hosts108• Host IP/DNS Name: <IP Address>• Database Server: <SQL Server Name>• Port Number: <

Strany 54 - Overview16

HP Storage Essentials SRM 6.0 User Guide 109a. Open SQL Server Enterprise Manager. b. Expand the user interface for SQL Server Enterprise Manager, and

Strany 55

Discovering Applications, Backup Hosts and Hosts110NOTE: To create the APPIQ_USER with a custom password, run CreateSybaseActCustomPwd.bat. For more i

Strany 56 - Overview18

HP Storage Essentials SRM 6.0 User Guide 111Removing the APPIQ_USER Account for SybaseIMPORTANT: Before you remove the APPIQ_USER account for the Syba

Strany 57 - Tape Libraries

HP Storage Essentials SRM 6.0 User Guide xv14Running Reports . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 58 - About Discovery

Discovering Applications, Backup Hosts and Hosts1125. In the Server Name box, enter the Sybase database you want to monitor.6. In the Port Number box,

Strany 59

HP Storage Essentials SRM 6.0 User Guide 113• The user name you provide could be either the Windows logon name or Common Name (CN) of the Active Direc

Strany 60 - Using Credentials

Discovering Applications, Backup Hosts and Hosts114Click OK.Deleting a Microsoft Exchange Domain ControllerTo delete all of the domain controllers of

Strany 61 - Discovery Steps

HP Storage Essentials SRM 6.0 User Guide 115NOTE: The required drivers for Caché were automatically installed along with the management server.IMPORTA

Strany 62 - Signing in to HP SIM

Discovering Applications, Backup Hosts and Hosts116• On IBM AIX, Linux, or HP-UX, log into an account that has administrative privileges, and mount th

Strany 63

HP Storage Essentials SRM 6.0 User Guide 117Figure 15 Selecting appiq.clsFor Caché 5.2 and Caché 2007.11. Launch the Caché System Management Portal by

Strany 64

Discovering Applications, Backup Hosts and Hosts118where DKA0 is a local drive on the OpenVMS host. c. Browse to $DKA0 and specify SQLPROJS.XML within

Strany 65 - Discovering Elements

HP Storage Essentials SRM 6.0 User Guide 119NOTE: If you are running Caché 5.2 or later, and the Caché instance was installed using “Locked Down” secu

Strany 66

Discovering Applications, Backup Hosts and Hosts120enter the custom password as the fourth argument. When invoking the scripts on OpenVMS, enclose the

Strany 67 - Discovering Switches

HP Storage Essentials SRM 6.0 User Guide 121For Caché 5.2 and later versions, if the Caché instance was installed using “Locked Down” security mode, e

Strany 68 - Discovering Brocade Switches

xviModifying a Zone Alias . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 525Deleting a Zone Alias

Strany 69 - After Upgrading

Discovering Applications, Backup Hosts and Hosts1224. Enter the Caché server name, the Super Server port number and the password of the _SYSTEM user a

Strany 70

HP Storage Essentials SRM 6.0 User Guide 1238. Click OK.IMPORTANT: Perform Discovery Data Collection for your inputs to take effect. See ”Step 3 — Dis

Strany 71

Discovering Applications, Backup Hosts and Hosts1242. To start discovering elements on the network, click the Start Discovery button on the IP Address

Strany 72 - Discovering CNT Switches

HP Storage Essentials SRM 6.0 User Guide 125Step C — Run Discovery Data CollectionObtain detailed information from the discovered applications as desc

Strany 73 - Discovering Cisco Switches

Discovering Applications, Backup Hosts and Hosts126IMPORTANT: If the management server cannot communicate with an application, it labels the applicati

Strany 74

HP Storage Essentials SRM 6.0 User Guide 127The management server requires the password to have the following characteristics:• a minimum of three cha

Strany 75

Discovering Applications, Backup Hosts and Hosts128

Strany 76

HP Storage Essentials SRM 6.0 User Guide 1294 Host and Application ClusteringSome of the features described in this chapter are not included in HP Sto

Strany 77

Host and Application Clustering130For information about discovering application clusters, see ”Discovering Applications, Backup Hosts and Hosts” on pa

Strany 78

HP Storage Essentials SRM 6.0 User Guide 1313. Cluster Manager Step 2 (Specify Cluster Properties and Cluster Members) is displayed. If you are discov

Strany 79

HP Storage Essentials SRM 6.0 User Guide xviiHost Security Groups on EMC CLARiiON and Sun 6130 Storage Systems . . . . . . . . . 553Host Security Gr

Strany 80

Host and Application Clustering132Filtering HostsThe Available Hosts table on Cluster Manager Step 2 (Specify Cluster Properties and Cluster Members)

Strany 81

HP Storage Essentials SRM 6.0 User Guide 133Clustering in System ManagerSystem Manager has been enhanced to seamlessly support clusters in all areas.

Strany 82

Host and Application Clustering134Double-click a cluster to open the Properties page for the cluster. Double-click an individual cluster node to open

Strany 83

HP Storage Essentials SRM 6.0 User Guide 135In the following figure, individual instances of Microsoft Exchange Server 2003 share HP EVA virtual disk

Strany 84 - Discovered

Host and Application Clustering136• Whole cluster capacity• Individual application instance capacity• Individual cluster node capacity• Capacity trend

Strany 85 - Discovering Storage Systems

HP Storage Essentials SRM 6.0 User Guide 1375 Managing SecurityIMPORTANT: Depending on your license, role-based security may not be available. See the

Strany 86

Managing Security138IMPORTANT: These roles apply only to features and elements in HP Storage Essentials. For example, assume you assigned a user to th

Strany 87

HP Storage Essentials SRM 6.0 User Guide 139SIMViewOnlyUsers created in HP Systems Insight Manager are automatically placed in the SIMViewOnly role. T

Strany 88

Managing Security140Options for Restricting a RoleIn addition, you can assign one of the following options within a role to further allow or restrict

Strany 89

HP Storage Essentials SRM 6.0 User Guide 141Users assigned to an organization can see only the elements that belong to that organization. If users are

Strany 90

xviiiDetermining if the Last Scheduled Backup was Successful . . . . . . . . . . . . . . . . . . . . . . . . . . . . 575Viewing the Summary Backup

Strany 91

Managing Security142• NYWebHost_Solaris• NYWebHosts• WebHosts• US East CoastFigure 21 Children in Multiple OrganizationsWhen you remove an element fro

Strany 92

HP Storage Essentials SRM 6.0 User Guide 143report. This is also true when you email reports. If you do not have permission to access hosts, the repor

Strany 93

Managing Security144• Viewing the Properties of an Organization, page 148Adding UsersThis section contains procedures for adding users and authorizing

Strany 94

HP Storage Essentials SRM 6.0 User Guide 145The users you created in HP SIM are put in the SIMViewOnly Role. This role does not allow users to access

Strany 95

Managing Security146NOTE: The Everything organization is the default organization that lets users access all current and future elements.11.Click OK.

Strany 96

HP Storage Essentials SRM 6.0 User Guide 1473. When you are done with your modifications, click Save Changes.Modifying Your User PreferencesUse the Us

Strany 97

Managing Security148• Role Description — A description of the role. • Access Level — How much access the user has to a type of element, such as hosts,

Strany 98

HP Storage Essentials SRM 6.0 User Guide 149• The Role Name and Description boxes do not accept special characters, except spaces and the following ch

Strany 99

Managing Security1501. Access Storage Essentials through one of the menu options, such as Options > Storage Essentials > Email Settings.2. In th

Strany 100

HP Storage Essentials SRM 6.0 User Guide 151• Removing Members from an Organization, page 154• Filtering Organizations, page 154Adding an Organization

Strany 101 - Discovering NAS Devices

HP Storage Essentials SRM 6.0 User Guide xixLUN Security and Zone Operation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 102

Managing Security152b. In the right-hand pane, select the elements you would like to add by clicking the appropriate check boxes.c. Click Add. d. The

Strany 103

HP Storage Essentials SRM 6.0 User Guide 153To access information about a child organization, click its link in the Child Organization column.Editing

Strany 104 - Discovering Sun NAS Devices

Managing Security154organization, you will still have access to hosts because you still belong to the onlyHosts organization.Keep in mind the followin

Strany 105 - Discovery Data Collection

HP Storage Essentials SRM 6.0 User Guide 155• Users assigned to the Admin account cannot filter organizations because the Admin account belongs to the

Strany 106

Managing Security156• DB_SYSTEM_USER — Used for all the database activity, including establishing a connection to the management server database. Defa

Strany 107 - Other Discovery Features

HP Storage Essentials SRM 6.0 User Guide 1575. Enter the current password in the Old Password box.6. Enter the new password in the New Password box.7.

Strany 108

Managing Security158Configuring the Management Server to Use Active DirectoryBy default, AD allows connections with domain\username, instead of with t

Strany 109

HP Storage Essentials SRM 6.0 User Guide 1596. Replace directory2.hp.com with the IP address or the fully qualified DNS name of your secondary Domain

Strany 110

Managing Security160<ActiveDirectory><PrimaryServer port="389">IP address of Primary Domain Controller</PrimaryServer><

Strany 111

HP Storage Essentials SRM 6.0 User Guide 161</LDAP></LoginHandler>When you are done with your changes, the login-handler.xml file, may res

Strany 112 - Viewing Log Messages

Legal and notice information© Copyright 2002-2008 Hewlett-Packard Development Company, L.P.Hewlett-Packard Company makes no warranty of any kind with

Strany 113

xxAdding Asset Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 645Adding General Informa

Strany 114 - Using Discovery Groups

Managing Security1622. In the login-handler.xml file, comment out the section that contains com.appiq.security.server.BasicLoginhandler, which enables

Strany 115 - Managing Discovery Groups

HP Storage Essentials SRM 6.0 User Guide 163<SearchBase>CN=$NAME$,OU=NetworkAdministration, dc=MyCompanyName,ou=US,dc=COM</SearchBase>The

Strany 116

Managing Security164<ssl>false</ssl><ShadowPassword>false</ShadowPassword><CaseSensitiveUserName>false</CaseSensitive

Strany 117 - Deleting Discovered Elements

HP Storage Essentials SRM 6.0 User Guide 165b. Enter the following at the command prompt to stop the management server:/etc/init.d/appstormanager stop

Strany 118

Managing Security166

Strany 119

HP Storage Essentials SRM 6.0 User Guide 1676 Managing LicensesSome of the features described in this chapter are not included in HP Storage Essential

Strany 120

Managing Licenses168Backup Size The management server determines licensing for Backup Manager through gigabytes (GB). The management server compares t

Strany 121

HP Storage Essentials SRM 6.0 User Guide 169IMPORTANT: The management server Current Usage Summary is first updated six hours after the management ser

Strany 122

Managing Licenses170Example 1: Assume you have the following environment:• Brocade (two switches of 12 ports each, one switch of 16 ports) — Total 40

Strany 123

HP Storage Essentials SRM 6.0 User Guide 171Assume you have the same configuration as the first example, with two Windows 2000 hosts that are directly

Strany 124

HP Storage Essentials SRM 6.0 User Guide xxiFiltering Assets by Status . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 125

Managing Licenses172To import a license file, 1. Select Deploy > Storage Essentials > License Manager > Manage Storage Essentials Keys in HP

Strany 126

HP Storage Essentials SRM 6.0 User Guide 173The license’s name and file name are listed, along with its properties. You can determine how many MAPs an

Strany 127

Managing Licenses174IMPORTANT: You must complete a Discovery Data Collection for the EVA arrays before importing the license and starting the collecto

Strany 128 - Monitoring Oracle

HP Storage Essentials SRM 6.0 User Guide 175Select Enhanced Performance Collection Enabling to select the EVA arrays you want to include for enhanced

Strany 129 - # cd /cdrom/DBIQ/oracle/unix

Managing Licenses1762. Go to the Webware Licensing website to use the HP Password Delivery Service, and redeem the license key for your product order.

Strany 130

HP Storage Essentials SRM 6.0 User Guide 1777 Configuring the Management ServerSome of the features described in this chapter aren’t included in HP St

Strany 131

Configuring the Management Server178The software does receive SNMP traps from some devices. These traps are translated into events in Event Manager. W

Strany 132

HP Storage Essentials SRM 6.0 User Guide 1793. Required: In the Name box, enter the DNS name or the IP address of the Simple Mail Transfer Protocol (S

Strany 133

Configuring the Management Server180• Paper height - Displays the height of the paper. You can modify the measurement in this field when you select th

Strany 134

HP Storage Essentials SRM 6.0 User Guide 181• Width - Determines the width of the printout. If the width entered does not fit on the page, the printou

Strany 135

xxii Linux . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 700Troubleshooting

Strany 136

Configuring the Management Server182• Include backup details - To obtain the latest backup information, select the Include backup details option, and

Strany 137

HP Storage Essentials SRM 6.0 User Guide 183• Include backup details - To obtain the latest backup information, select the Include backup details opti

Strany 138

Configuring the Management Server184Editing a ScheduleTo edit a schedule:1. Select Options > Storage Essentials > Discovery > Schedule Discov

Strany 139

HP Storage Essentials SRM 6.0 User Guide 185To apply the filter settings, click Filter to refresh the content of the page. To restore the filters to t

Strany 140

Configuring the Management Server186• Database alert log - The Database Alert Log scans the management server for critical errors at a specified inter

Strany 141

HP Storage Essentials SRM 6.0 User Guide 1871. Select Options > Storage Essentials > Manage Product Health in HP Systems Insight Manager.2. Sele

Strany 142

Configuring the Management Server188• Accessing the Log Files, page 188• Downloading Logs to a File Using the Download Logs Feature, page 190• Downloa

Strany 143

HP Storage Essentials SRM 6.0 User Guide 189Log file timestamp - A timestamp (YYMMDD-HHMMSS) is inserted into the filename at its creation, making its

Strany 144

Configuring the Management Server190Adding trace for XML received from CIMOM - Traces are normally very large files. For that reason, the trace is tur

Strany 145

HP Storage Essentials SRM 6.0 User Guide 191NOTE: The Log Download Utility does not trigger CIMOM thread dumps, Environment variable dumps, Port usage

Strany 146

HP Storage Essentials SRM 6.0 User Guide xxiiiERROR replicating APPIQ_EVAStorageVolume during Discovery Data Collection for an EVA array. 719Recalcu

Strany 147

Configuring the Management Server192Downloading the Discovery Summary LogYou can view status information from Discovery Data Collection by viewing the

Strany 148

HP Storage Essentials SRM 6.0 User Guide 193Use the table ”Logging Levels” on page 192 as a guideline for the different options. Several of the option

Strany 149

Configuring the Management Server194Enabling the Scanning of Critical Events of the Management Server DatabaseYou can configure the management server

Strany 150 - Monitoring Microsoft Exchange

HP Storage Essentials SRM 6.0 User Guide 195Controlling the Display of Cleared and Deleted EventsYou can control how the management server displays ev

Strany 151

Configuring the Management Server196Configuring the Clearing of EventsDepending on the severity of an event, the management server may mark the event

Strany 152 - Monitoring Caché

HP Storage Essentials SRM 6.0 User Guide 197To change the default time delay to delete an event:1. Select Options > Events > Storage Essentials

Strany 153

Configuring the Management Server198• Next Scheduled Run - Displays the next time the management server is scheduled to obtain image details from the

Strany 154

HP Storage Essentials SRM 6.0 User Guide 1995. Set the date, time, and repeat interval for this task. For more information, see ”Setting the Date and

Strany 155

Configuring the Management Server200• Interval (Minutes) - Displays how often the management server is scheduled to obtain drive monitoring details.•

Strany 156

HP Storage Essentials SRM 6.0 User Guide 201views are refreshed, as described in ”Refreshing the Report Cache” on page 208. The overall report archite

Strany 157

xxivZ. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 734Index . . . . . . . . . .

Strany 158

Configuring the Management Server202Report Refresh StatusThe management server has two types of views for its reports. During a report cache refresh,

Strany 159

HP Storage Essentials SRM 6.0 User Guide 2036. Enter the following at the command prompt:order by 2;Managing Collectors for ReportsThe management serv

Strany 160

Configuring the Management Server204Starting CollectorsIMPORTANT: After you click OK, if the date and time you set has not passed, the collector start

Strany 161 - Deleting Caché Information

HP Storage Essentials SRM 6.0 User Guide 2053. Set the date, time, and repeat interval for this task. For more information, see ”Editing a Collector S

Strany 162 - Step B — Obtain the Topology

Configuring the Management Server206Editing E-mail Schedules for ReportsIMPORTANT: Schedule your reports to be sent soon after a report cache refresh.

Strany 163

HP Storage Essentials SRM 6.0 User Guide 207If you are e-mailing reports in bulk, you might want to let users know the e-mail is being sent by an auto

Strany 164

Configuring the Management Server208IMPORTANT: Perform the following steps only if customer support has instructed you to modify one of the collectors

Strany 165

HP Storage Essentials SRM 6.0 User Guide 209Keep in mind the following:• If Discovery Data Collection is occurring, wait for it to finish before click

Strany 166

Configuring the Management Server210When you set up Global Reporter, the management server pulls the data from the local database views at these sites

Strany 167 - Discovering Clusters

HP Storage Essentials SRM 6.0 User Guide 211Keep in mind the following when setting up global reporting:• Multiple Global Reporter Servers - Global re

Strany 168

HP Storage Essentials SRM 6.0 User Guide xxvFigures1 Accessing Features from the Tools > Storage Essentials Menu . . . . . . . . . . . . . . . . .

Strany 169

Configuring the Management Server212• Unable to Contact Site - If the management server is unable to contact one of the sites in the Global Reporting

Strany 170 - File Servers and Clusters

HP Storage Essentials SRM 6.0 User Guide 213Keep in mind the following:• The remote site is not required to have global reporting enabled in its licen

Strany 171 - Clustering in System Manager

Configuring the Management Server2144. Modify the following information for your remote servers that are running the management server:• IP Address -

Strany 172 - Clustering in Topology

HP Storage Essentials SRM 6.0 User Guide 215Now, let's assume you removed remotesiteA from the user interface by clicking the corresponding but

Strany 173

Configuring the Management Server216The instructions also remind you to refer to Help for additional information.After you package the necessary files

Strany 174

HP Storage Essentials SRM 6.0 User Guide 217Deleting Custom ReportsIf you want to delete imported custom reports by clicking Delete, the system displa

Strany 175 - 5 Managing Security

Configuring the Management Server218To apply the filter settings, click Filter to refresh the content of the Report Data Collector page. To restore th

Strany 176 - Managing Security138

HP Storage Essentials SRM 6.0 User Guide 219Starting Performance CollectorsTo start a collector:1. Access the page for performance collectors (Optimiz

Strany 177

Configuring the Management Server220The collector stops gathering information for its corresponding reports.To stop more than one collector at once, s

Strany 178 - About Organizations

HP Storage Essentials SRM 6.0 User Guide 221Editing the Locale and Currency SettingsThe management server determines which languages and currency to d

Strany 179

xxvi47 Enclosing the Elements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27548 Dragging Mul

Strany 180 - Managing Security142

Configuring the Management Server222IMPORTANT: You must restart the management server for your changes to take effect.Process NamesThis section descri

Strany 181 - Managing User Accounts

HP Storage Essentials SRM 6.0 User Guide 223NOTE: If you are using the prstat utility, all of the processes will be named java.exe.Editing a Collector

Strany 182 - Adding Users

Configuring the Management Server224

Strany 183 - Editing a User Account

HP Storage Essentials SRM 6.0 User Guide 2258 Database Maintenance and ManagementThis chapter contains information about backing up and restoring the

Strany 184 - Modifying Your User Profile

Database Maintenance and Management226NOTE: The archive directory (\oracle\oradata\APPIQ\archive on Microsoft Windows and $ORACLE_HOME/oradata/APPIQ/a

Strany 185

HP Storage Essentials SRM 6.0 User Guide 227IMPORTANT: Export and RMAN backups should be done regularly and in combination. Backup Destination and O

Strany 186 - Managing Roles

Database Maintenance and Management228The scheduled backup writes in the backup1 and backup2 folders, in rotation. The Backup Now backup from the mana

Strany 187 - Editing Roles

HP Storage Essentials SRM 6.0 User Guide 229• If the database fails as a result of a corrupt data file, the database can only be restored to the last

Strany 188 - Managing Organizations

Database Maintenance and Management230Keep in mind the following:• Only one user at a time can back up the database.• The management server archives f

Strany 189 - Adding an Organization

HP Storage Essentials SRM 6.0 User Guide 231Performing an RMAN Hot BackupYou can perform an RMAN hot backup instantly. The backup is referred to as be

Strany 190 - Viewing Organizations

HP Storage Essentials SRM 6.0 User Guide xxvii94 Report Architecture . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 191 - Removing an Organization

Database Maintenance and Management2321. Verify that you have enabled database archive mode and RMAN backup as described in ”Changing the Archive Mode

Strany 192 - Filtering Organizations

HP Storage Essentials SRM 6.0 User Guide 2331. Click Options > Storage Essentials > Manage Product Health in HP Systems Insight Manager.2. Selec

Strany 193

Database Maintenance and Management2342. Access the database utility by doing the following on the management server:•On Linux:a. Set the display if y

Strany 194 - Managing Security156

HP Storage Essentials SRM 6.0 User Guide 235IMPORTANT: Do not use the Oracle tools to change the passwords.• SYS - Used for the management server data

Strany 195

Database Maintenance and Management236d. Stop the HP Systems Insight Manager service so that it cannot access the database. It is very important that

Strany 196

HP Storage Essentials SRM 6.0 User Guide 237save you time with exporting the database if your database includes a large amount of report data.7. Click

Strany 197

Database Maintenance and Management238Re-initializing the DatabaseCAUTION: Do not use the Database Admin Utility to re-initialize the HP SIM database.

Strany 198

HP Storage Essentials SRM 6.0 User Guide 239c. Type the password of the SYSTEM account. Then, click OK. The default password of the SYSTEM account is

Strany 199

Database Maintenance and Management240RMAN Backup. The backup is referred to as being “cold” because the management server is not running while the ba

Strany 200

HP Storage Essentials SRM 6.0 User Guide 241•The Disable RMAN backup button is displayed if the archive mode is currently enabled. Select this option

Strany 201

xxvi-ii

Strany 202 - Admin Account

Database Maintenance and Management242• Management server RMAN backup files —These files contain information about the elements your management server

Strany 203

HP Storage Essentials SRM 6.0 User Guide 2431. Access the Database Admin Utility as described in ”Accessing the Database Admin Utility” on page 233.2.

Strany 204 - Managing Security166

Database Maintenance and Management244Warning Messages During Reinitializing the DatabaseWhen you use the Database Admin Utility to re-initialize the

Strany 205 - 6 Managing Licenses

HP Storage Essentials SRM 6.0 User Guide 245For example, if the management server is managing two Oracle and two Sybase database applications, ask the

Strany 206 - Managing Licenses168

Database Maintenance and Management246• Only the admin user will be able to log into the management server, no other user will be able to log in to th

Strany 207

HP Storage Essentials SRM 6.0 User Guide 247• From the Database Admin Utility. See ”Checking the Database and Listener Status” on page 234. Checking D

Strany 208 - Managing Licenses170

Database Maintenance and Management248

Strany 209 - Importing a License File

HP Storage Essentials SRM 6.0 User Guide 2499 Viewing Element Topology and PropertiesSome of the features described in this chapter are not included i

Strany 210 - Viewing a Specific License

Viewing Element Topology and Properties250NOTE: To view direct-attached storage, you must enable the button. See Table 29 on page 253 for more infor

Strany 211 - Deleting a License

HP Storage Essentials SRM 6.0 User Guide 251• Navigation - The Navigation tab provides information about an element and how it relates to other elemen

Strany 212 - Managing Licenses174

HP Storage Essentials SRM 6.0 User Guide xxixTables1 Document conventions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 213

Viewing Element Topology and Properties252belong to the same fabric. The management server displays switch_A and switch_B under the same fabric withou

Strany 214 - Managing Licenses176

HP Storage Essentials SRM 6.0 User Guide 253Table 29 Feature of the Toolbar in System ManagerButton DescriptionPrints the topology. See ”Printing the

Strany 215 - Trap Generation

Viewing Element Topology and Properties254Saves the current topology, so that when you return to System Manager, the saved layout is restored. This op

Strany 216

HP Storage Essentials SRM 6.0 User Guide 255Icons Displayed in the TopologyTable 30 on page 255 provides a brief description of the icons displayed in

Strany 217 - Configuring Print Settings

Viewing Element Topology and Properties256The List TabThe List tab provides information about the elements by type, by cluster, or by fabric and domai

Strany 218

HP Storage Essentials SRM 6.0 User Guide 257When you click a fabric name in the tree, its members are highlighted in the right pane, as shown in the f

Strany 219

Viewing Element Topology and Properties258Applications node, the applications are highlighted in the topology, as shown in the following figure.Figure

Strany 220 - Adding a Discovery Schedule

HP Storage Essentials SRM 6.0 User Guide 259Obtaining Information About Zone EntriesTo view the zone entries in a domain, expand the tree for the doma

Strany 221 - Disabling a Schedule

Viewing Element Topology and Properties260• Click the node of the zone in the tree. The software highlights the zone members in the right pane.Figure

Strany 222 - Removing a Schedule

HP Storage Essentials SRM 6.0 User Guide 261To view information about a zone member's port, expand the zone member node, as shown in the followin

Strany 223 - Managing Product Health

HP Storage Essentials SRM 6.0 User Guide iiiContentsAbout this Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 224

xxx47 Supported Hardware for Events. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33248 Default Settings for Clea

Strany 225 - Managing Logging

Viewing Element Topology and Properties262When you click the HBA node, the host and the element to which it has the binding are highlighted. A green l

Strany 226 - About Log Files

HP Storage Essentials SRM 6.0 User Guide 263displayed under the node, and the storage system is highlighted in the right pane, as shown in the followi

Strany 227

Viewing Element Topology and Properties264When you expand a domain node, if any of the paths for hosts are not fully calculated, a pop-up dialog box d

Strany 228 - #wbem.debug.sml=1

HP Storage Essentials SRM 6.0 User Guide 265You can also determine the elements in a hosts path by expanding the Application Path and Path nodes under

Strany 229 - AllLogsxx-xx.zip

Viewing Element Topology and Properties266NOTE: Right-click menu options are not available to undiscovered fabrics.Table 31 Menu Options Accessible fr

Strany 230

HP Storage Essentials SRM 6.0 User Guide 267External Tools Provides several ways to access an element:• Telnet - Lets you access a host or a switch th

Strany 231

Viewing Element Topology and Properties268Provision Provides provisioning tools for switches and storage systems:Switches - Lets you activate and deac

Strany 232 - Database

HP Storage Essentials SRM 6.0 User Guide 269* Additional menu items may appear for types of automators and advisors, such as Reachable Storage. The de

Strany 233

Viewing Element Topology and Properties270your kit. To determine if you can access Provisioning Manager, access the List of Features, which is accessi

Strany 234

HP Storage Essentials SRM 6.0 User Guide 2711When McDATA and Connectrix switches are discovered through a proxy by SNMP, you cannot view or perform an

Strany 235 - Managing Backup Collection

HP Storage Essentials SRM 6.0 User Guide xxxi94 MVCA_VIRTUALAPPCAPACITYVW . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 236

Viewing Element Topology and Properties272• Using the Global View, page 276• Printing the Topology, page 276• Exporting the Topology to Microsoft Visi

Strany 237 - Drive Monitoring

HP Storage Essentials SRM 6.0 User Guide 273Adding Information for Discovered HostsThe software labels a host as discovered when it cannot obtain addi

Strany 238 - Managing Reports

Viewing Element Topology and Properties274Arranging Elements in the TopologyTo improve usability, arrange the topology so it suits your environment. F

Strany 239

HP Storage Essentials SRM 6.0 User Guide 275A square encloses the elements, as shown in the following figure. If you want to redo the square, just cli

Strany 240 - Report Refresh Status

Viewing Element Topology and Properties276Closing Topology WindowsWhenever you select a new topology view, the software creates a pane for that view.

Strany 241

HP Storage Essentials SRM 6.0 User Guide 277• Bottom margin - Enter a measurement.• Left margin - Enter a measurement.• Right margin - Enter a measure

Strany 242 - Starting Collectors

Viewing Element Topology and Properties27810.To preview your pages, click the Preview tab. Then click the page you want to preview.The page appears in

Strany 243 - Stopping Collectors

HP Storage Essentials SRM 6.0 User Guide 2792. Click Next. The Select Destination Location windows is displayed. 3. Click Next.The Select Components w

Strany 244

Viewing Element Topology and Properties28012.Click OK.13.Restart Visio, and select Enable Macros when prompted.NOTE: If the Storage Planner menu item

Strany 245

HP Storage Essentials SRM 6.0 User Guide 281• Right-click an element, and then select Show Element Topology from the menu.2. Right-click an element in

Strany 246 - Refreshing the Report Cache

xxxii141 Right-Click Menu Options on the Topology Tab . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 583142 Right-Click Menu Options on th

Strany 247 - Setting Up Global Reporter

Viewing Element Topology and Properties282in yellow. This means that if any of these highlighted elements are removed from the network, klu2e may have

Strany 248

HP Storage Essentials SRM 6.0 User Guide 283Assigning a Business Cost to an ApplicationThe management server lets you assign a business cost to an app

Strany 249

Viewing Element Topology and Properties284example, a storage system has a value of $60 if two $30 applications are in its path, as shown in the follow

Strany 250

HP Storage Essentials SRM 6.0 User Guide 285Expanding the Topology PaneTo increase screen space for viewing the topology, hide the List, Access, and P

Strany 251

Viewing Element Topology and Properties286NOTE: The Event Status button ( ) is disabled in Capacity Manager and Performance Manager.The icon correspon

Strany 252

HP Storage Essentials SRM 6.0 User Guide 287Since the severity level for an element is set by the manufacturer, the meanings of the severity levels va

Strany 253

Viewing Element Topology and Properties288• Do not create groups during Get Topology or Discovery Data Collection. You can determine if the management

Strany 254

HP Storage Essentials SRM 6.0 User Guide 289• A user's role must include an access level of Element Control or Full Control for hosts. See the to

Strany 255 - Deleting Custom Reports

Viewing Element Topology and Properties290• Connected Switches - To sort storage systems by connected switches, click the Connected Switches column he

Strany 256

HP Storage Essentials SRM 6.0 User Guide 2914. Select Change Fabric Name from the menu.5. In the Enter a Fabric Name box, enter a new fabric name.6. C

Strany 257

HP Storage Essentials SRM 6.0 User Guide xxxiii

Strany 258

Viewing Element Topology and Properties292The management server provides two variations of this feature:• Hiding Generic Hosts for One Switch: This fe

Strany 259

HP Storage Essentials SRM 6.0 User Guide 293Expanding Generic Hosts for All SwitchesTo display hidden generic hosts for a domain:1. Right-click a swit

Strany 260 - Process Names

Viewing Element Topology and Properties294If you want a Perl script to run as a custom command on Microsoft Windows, you must prefix the script name w

Strany 261 - Editing a Collector Schedule

HP Storage Essentials SRM 6.0 User Guide 295If the file is missing, repeat step 3.8. Select one of the following options to determine the elements for

Strany 262

Viewing Element Topology and Properties296Editing a Custom CommandTo edit a custom command:1. Right-click an element in System Manager.2. Select Custo

Strany 263 - Database Maintenance Window

HP Storage Essentials SRM 6.0 User Guide 297Table 36 on page 296 lists variables that can be used to gather information for storage systems, switches,

Strany 264 - Overview of Backups

Viewing Element Topology and Properties298Table 39 on page 297 lists variables that can be used to gather information for applications. Use the variab

Strany 265

HP Storage Essentials SRM 6.0 User Guide 299Using the Remote ConsoleThis section contains the following topics:• About the Remote Console, page 298• K

Strany 266 - Database Mode

Viewing Element Topology and Properties300example, you can use the remote console to start a remote command prompt on the management server. Figure 53

Strany 267

HP Storage Essentials SRM 6.0 User Guide 3016. In the Command Line box, enter the following command, which will run on the management server:cmd /k7.

Strany 269 - Scheduling RMAN Hot Backups

Viewing Element Topology and Properties302Menu OptionsThe remote console also provides the following menu options.Copying Text from the Remote Console

Strany 270

HP Storage Essentials SRM 6.0 User Guide 303• Set up external tools - Lets you add a URL for accessing management software, such as Hitachi HiCommand

Strany 271

Viewing Element Topology and Properties304• If you see a message that zone aliases are not supported on a Brocade switch, perform Discovery Data Colle

Strany 272

HP Storage Essentials SRM 6.0 User Guide 305in the page. You are shown information about the dependent hosts, as shown in the following figure:Figure

Strany 273

Viewing Element Topology and Properties306*The management server displays cxfs for SGI IRIX computers if it detects CXFS on the cluster. On individual

Strany 274 - Exporting the Database

HP Storage Essentials SRM 6.0 User Guide 3073. Click the Ports button in the Physical column in the Navigation tab, as shown in the following figure.F

Strany 275 - Importing the Database

Viewing Element Topology and Properties308Accessing the Navigation TabTo access the Navigation tab:1. Access the management server. 2. To access the N

Strany 276 - Re-initializing the Database

HP Storage Essentials SRM 6.0 User Guide 309• Version (Generic Hosts Only) - Enter a version number for a generic host.• Operating System (Generic Hos

Strany 277 - Restoring a Cold Backup

Viewing Element Topology and Properties310You can view the following properties of a fabric: • Vendor - The vendor name. • Created - The first time th

Strany 278 - Changing the Archive Mode

HP Storage Essentials SRM 6.0 User Guide 311IMPORTANT: Do not update element data during Get Topology or Discovery Data Collection. You can determine

Strany 279 - Running a Cold Backup

HP Storage Essentials SRM 6.0 User Guide xxxvAbout this GuideThis guide provides information about:• Discovering elements• Managing Security • Configu

Strany 280 - Downloading Log Files

Viewing Element Topology and Properties312in the following figure. According to the following figure, the server can access three storage systems: LSI

Strany 281 - Database Admin Log File

HP Storage Essentials SRM 6.0 User Guide 313The topology extends the length of the screen. The second portion of the topology is provided by the follo

Strany 282 - About Database Passwords

Viewing Element Topology and Properties314access a storage system. Another is providing redundant paths from the host to the switch. To determine if y

Strany 283 - Generating a Support Database

HP Storage Essentials SRM 6.0 User Guide 315Figure 59 Multipathing Displayed in the TopologyThe topology extends the length of the screen. The followi

Strany 284

Viewing Element Topology and Properties316Figure 60 Multipathing Displayed in the Topology (Continued)Keep in mind the following:• If you do not see a

Strany 285

HP Storage Essentials SRM 6.0 User Guide 317Once the button is enabled, the management server displays the link between the storage system port and

Strany 286

Viewing Element Topology and Properties318Table 44 The Toolbar in the Topology TabIcon DescriptionPrints the topology. See ”Printing the Topology” on

Strany 287 - About System Manager

HP Storage Essentials SRM 6.0 User Guide 319About the New Window OptionThe New Window option in System Manager lets you view several sections of the t

Strany 288

Viewing Element Topology and Properties320to move. Drag the element to its new location. Moving elements closer together provides a more compact print

Strany 289 - Accessing System Manager

HP Storage Essentials SRM 6.0 User Guide 321IMPORTANT: Before you change the margins, decide on a unit of measurement.• Unit - Select cm (centimeters)

Strany 290 - System Manager

xxxviDocument Conventions and SymbolsWARNING! Indicates that failure to follow directions could result in bodily harm or death.CAUTION: Indicates that

Strany 291

Viewing Element Topology and Properties322• Description• Vendor• Version5. Click Next.6. Select a storage volume containing the application for which

Strany 292

HP Storage Essentials SRM 6.0 User Guide 323• Severity - The severity level• Time - The time the event was recorded.• Summary Text - A brief explanati

Strany 293

Viewing Element Topology and Properties324• ”Adding Custom Information” on page 647Figure 63 Viewing Asset RecordsTo set up chargeback, expand the Cha

Strany 294 - The List Tab

HP Storage Essentials SRM 6.0 User Guide 325• Asset Tag - The asset tag assigned to the element.• Asset Category - The asset category assigned to the

Strany 295 - Viewing Elements by Type

Viewing Element Topology and Properties326About the Policies TabThe Policies tab lets you view the utilization policies for an element. Utilization po

Strany 296 - The Access Tab

HP Storage Essentials SRM 6.0 User Guide 327If a storage volume is a member of a shared file system, such as CXFS or XFS, it is listed in the Storage

Strany 297

Viewing Element Topology and Properties328

Strany 298

HP Storage Essentials SRM 6.0 User Guide 32910 Event ManagementHP Storage Essentials Standard Edition supports a subset of the devices supported by En

Strany 299

Event Management330• Clear Selected - Marks the selected events as cleared.• Clear All - Marks all events as cleared.• Un-clear Selected - Removes the

Strany 300

HP Storage Essentials SRM 6.0 User Guide 331Accessing Event ManagerTo access Event Manager, do one of the following:• To view events from all elements

Strany 301 - About the Path Tab

HP Storage Essentials SRM 6.0 User Guide xxxviiTIP: Provides helpful hints and shortcuts.HP Technical SupportTelephone numbers for worldwide technical

Strany 302

Event Management332Event Manager IconsThe following icons are displayed in Event Manager.Events SupportedEvent Manager does not support events from al

Strany 303

HP Storage Essentials SRM 6.0 User Guide 333McDATA switches SNMP to switchesY Need to configure the switch or proxy to send traps to the management se

Strany 304

Event Management334Viewing Events from the Management ServerBy default the management server displays events from all of the elements, regardless of t

Strany 305

HP Storage Essentials SRM 6.0 User Guide 335Event Manager displays events it receives from CNT InVsn Enterprise Manager. As of version 9.5, InVsn Ente

Strany 306

Event Management3362. In Event Manager click the event summary, as shown in the following figure.Figure 67 Accessing Event DetailsThe event details ar

Strany 307

HP Storage Essentials SRM 6.0 User Guide 337NOTE: Events listed in Event Manager may not be attributed to the correct source until Discovery Data Coll

Strany 308

Event Management338To change the default time delay before clearing an event, do the following:1. Select Configuration > Events to access the Event

Strany 309 - Viewing Storage Elements

HP Storage Essentials SRM 6.0 User Guide 339For example, if you want events that are a week old deleted, select Weeks in the combo box in the Automati

Strany 310 - Adding a Virtual Application

Event Management3404. Click Add Journal Entry.The entry is added with the user's account name and the date and time it was added.Changing the CLA

Strany 311

HP Storage Essentials SRM 6.0 User Guide 341Brocade Switch EventsWhen a Brocade switch generates an event, it assigns a code instead of an event sever

Strany 312

xxxviii

Strany 313

Event Management342*This term does not appear in the event description, but is provided for clarity. Supported Brocade EventsThe Event Manager display

Strany 314 - Printing the Topology

HP Storage Essentials SRM 6.0 User Guide 343• Cleared status• Specific elementTo set up a filter:1. To access the filter for Event Manager, click the

Strany 315

Event Management344• Minor - Only events of the severity type, minor, are displayed.• Major - Only events of the severity type, major, are displayed.•

Strany 316 - Installing Storage Planner

HP Storage Essentials SRM 6.0 User Guide 345•30 seconds•1 minute•5 minutes•10 minutes10.When you are done setting your options, click the Filter butto

Strany 317

Event Management346b. In the Calendar, select the start date. Figure 74 Selecting a datec. In the Time field, enter the start time. The time is based

Strany 318 - Viewing Ports

HP Storage Essentials SRM 6.0 User Guide 347b. In the Calendar, select the end date. Figure 75 Selecting a datec. In the Time field, enter the end tim

Strany 319

Event Management348The filtering feature is displayed, as shown in the following figure:Figure 77 The Filter feature in Event Manager2. Click the Rese

Strany 320

HP Storage Essentials SRM 6.0 User Guide 349IMPORTANT: Once the Advanced Options heading has been expanded, the Element Name Contains field becomes in

Strany 321

Event Management350For example, in the following figure Host_13081 and Host_10380 were selected for advanced filtering, so they are listed under the A

Strany 322

HP Storage Essentials SRM 6.0 User Guide 351Clearing Advance Filtering OptionsYou can clear the filtering set for advanced options, by clicking the Cl

Strany 323 - Filtering Fabrics

HP Storage Essentials SRM 6.0 User Guide 11OverviewThis chapter contains the following topics:• About This Product, page 1• Standard Edition and Enter

Strany 324

Event Management3525. To filter events by severity, use the <event-filter-severity> tag. For example, to prevent informational events from being

Strany 325 - Managing Groups

HP Storage Essentials SRM 6.0 User Guide 353

Strany 327

HP Storage Essentials SRM 6.0 User Guide 35511 Finding an Element’s Storage CapacityIMPORTANT: Depending on your license, Capacity Manager may not be

Strany 328 - Managing Fabrics

Finding an Element’s Storage Capacity356• The Capacity Manager displays the total capacity of an application, including the network drives. If you loo

Strany 329 - About Hiding Generic Hosts

HP Storage Essentials SRM 6.0 User Guide 357The colors indicate that the element displayed in the following figure is about 75 percent available. The

Strany 330

Finding an Element’s Storage Capacity358NOTE: Capacity Manager provides additional tabs for NetApp NAS devices. The toolbars are the same.Table 51 Too

Strany 331 - Setting Up Custom Commands

HP Storage Essentials SRM 6.0 User Guide 359Applications and hosts only: Lets you change the display frequency. The options are the following:• Hourly

Strany 332 - Adding a Custom Command

Finding an Element’s Storage Capacity360Finding the Capacity of an ElementNOTE: Capacity Manager rounds the data it displays. As a result, the totals

Strany 333

HP Storage Essentials SRM 6.0 User Guide 361The following additional information is displayed for each storage group (Microsoft Exchange) or database

Strany 334 - Deleting a Custom Command

ivSigning in to HP SIM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24Enabling Product He

Strany 335

Overview2Storage Essentials, not in HP Systems Insight Manager. When you select Tools > Storage Essentials, you see a submenu listing several featu

Strany 336 - APPIQ_ELEMENT_DOMAIN

Finding an Element’s Storage Capacity362• Volume Name• Aggregate Available• Aggregate Used• Volume Maximum• Volume Used• Percentage Volume UsedCapacit

Strany 337 - Using the Remote Console

HP Storage Essentials SRM 6.0 User Guide 363• Quota Soft Limit — The amount of disk space or the number of files that would have to be exceeded before

Strany 338

Finding an Element’s Storage Capacity364volumes have been allocated from those disk groups. For example, on CLARiiON storage systems these are disks t

Strany 339 - Buttons on the Remote Console

HP Storage Essentials SRM 6.0 User Guide 365IMPORTANT: For arrays that permit RAID choice when creating volumes (for exaple the EVA), the concept of f

Strany 340 - Using External Tools

Finding an Element’s Storage Capacity366Obtaining Utilization ReportsThe software provides the following utilization reports to help you determine how

Strany 341 - About the Navigation Tab

HP Storage Essentials SRM 6.0 User Guide 367To print the elements in Capacity Manager:1. Access Capacity Manager as described in ”Accessing Capacity M

Strany 342

Finding an Element’s Storage Capacity368NOTE: To change the orientation of the chart, hold down the mouse button when you click the chart, and continu

Strany 343

HP Storage Essentials SRM 6.0 User Guide 3699. Click the button to update the chart.10.To print the chart, click the button displayed in the same

Strany 344

Finding an Element’s Storage Capacity370The difference between the two calculations is the capacity reserved for superuser. If a file system has a res

Strany 345

HP Storage Essentials SRM 6.0 User Guide 37112 Managing PoliciesDepending on your license, Policy Manager may not be available. See the List of Featur

Strany 346 - Viewing Element Properties

HP Storage Essentials SRM 6.0 User Guide 3To access the online help for Storage Essentials, access Storage Essentials, and click Help > For this pa

Strany 347 - Viewing Fabric Properties

Managing Policies372• successful provisioning• the occurrance of an event on one or more specified elementsAccessing Policy ManagerThis section descri

Strany 348 - Assigning a Custom Name

HP Storage Essentials SRM 6.0 User Guide 373• Send E-mail - Policy Manager sends an e-mail when the condition is fulfilled. Enter a comma-separated li

Strany 349 - Viewing Element Topology

Managing Policies374Manager so you receive an e-mail message when the amount of free space on a server decreases to a specified level.Keep in mind the

Strany 350

HP Storage Essentials SRM 6.0 User Guide 37515.To test a policy, click the Test button in the Utilization Policy table. The management server fires a

Strany 351 - Multipathing

Managing Policies376Free Space TrendingA forecast of amount of free space on one of the following:• A host• A database instance, such as Microsoft SQL

Strany 352

HP Storage Essentials SRM 6.0 User Guide 377Creating Policies for DiscoveryYou can create an infrastructure policy that generates an event, sends an e

Strany 353

Managing Policies3781. Access Policy Manager as described in the topic, ”Accessing Policy Manager” on page 372.2. In the Policy Manager tree, expand t

Strany 354 - Direct Attached Storage

HP Storage Essentials SRM 6.0 User Guide 3796. Select one or more element types.When a condition is fulfilled on a select element, Policy Manager gene

Strany 355 - Accessing the Topology

Managing Policies380IMPORTANT: Since the severity level for an element is set by the manufacture, the meanings of the severity levels vary. It is best

Strany 356

HP Storage Essentials SRM 6.0 User Guide 381• Modifying Utilization and Backup Policies, page 381• Modifying Discovery Policies, page 381• Modifying P

Strany 357 - About the New Window Option

Overview4dependencies and view and manage your infrastructure as a whole. A SAN is a network configuration that is dedicated to transporting storage d

Strany 358

Managing Policies3827. Select Fire when event is cleared if you want the policy to act when the event is cleared. If you do not select "Fire when

Strany 359

HP Storage Essentials SRM 6.0 User Guide 383IMPORTANT: Specify shorter periods for important applications.7. Select or deselect one or more element ty

Strany 360 - About the Events Tab

Managing Policies384Deactivating a PolicyPolicies are activated when they are created. You can deactivate a policy, but still keep it stored in the ma

Strany 361

HP Storage Essentials SRM 6.0 User Guide 385• First assign an SMTP server from which the management server can send its e-mail notifications. See ”Set

Strany 362

Managing Policies386Providing a Custom Command for a PolicyYou can configure Policy Manager to run a custom command on the management server when an e

Strany 363 - About the Monitoring Tab

HP Storage Essentials SRM 6.0 User Guide 38713 Viewing Performance Data Depending on your license, Performance Manager may not be available. See the L

Strany 364 - About the Policies Tab

Viewing Performance Data388Array Performance Pack RequirementsThe following paragraphs describe important requirements and considerations for licensin

Strany 365

HP Storage Essentials SRM 6.0 User Guide 389Command View version v7.01, or later, is highly recommended to take best advantage of the enhancements. Th

Strany 366

Viewing Performance Data390A screen similar to the following displays. Figure 89 Data Collector SelectionSelect the desired collectors from those list

Strany 367 - 10 Event Management

HP Storage Essentials SRM 6.0 User Guide 391When licensed appropriately, you can review the collected data in Performance Manager. You can expand the

Strany 368 - Event Management330

HP Storage Essentials SRM 6.0 User Guide 5Suggested Topics for First-Time UsersAs a first-time user, you should first become familiar with discovery a

Strany 369 - Accessing Event Manager

Viewing Performance Data392For example, the following representative screen display shows information about data rates associated with the highlighted

Strany 370 - Event Manager Icons

HP Storage Essentials SRM 6.0 User Guide 393Command View EVA supports a standby configuration whereby an array can be managed by multiple Command View

Strany 371

Viewing Performance Data394• The minimum collection interval that can be set for the EVA performance data collectors is 1 minute. The collection inter

Strany 372 - Event Management334

HP Storage Essentials SRM 6.0 User Guide 3952. Select the element you want to monitor.3. Under the Monitoring tab in the lower-left pane, select the e

Strany 373 - Viewing Event Details

Viewing Performance Data396Lets you determine the unit of measurement in the graph. Select one of the following options, and then click the button:•

Strany 374 - Event Management336

HP Storage Essentials SRM 6.0 User Guide 397Lets you modify the performance data displayed in the graph and change graph settings. When you select it,

Strany 375 - Clearing Events

Viewing Performance Data398Comparing the Performance of Different ElementsUse Performance Manager to compare the performance of different elements. Le

Strany 376 - Event Management338

HP Storage Essentials SRM 6.0 User Guide 399To view a summary chart:1. Access Performance Manager as described in ”Accessing Performance Manager” on p

Strany 377 - Adding Journal Entries

Viewing Performance Data400NOTE: If there is not enough data to display, Performance Manager does not display the chart. For example, if you selected

Strany 378 - Brocade Events

HP Storage Essentials SRM 6.0 User Guide 4017. Click the calendar button to the right of the Start box.8. Enter the time in the time box. Make sure

Strany 379 - Brocade Switch Events

Overview6network, so that the management server becomes aware of them. Then you must run Discovery Data Collection, so that the management server is a

Strany 380 - Filtering Events

Viewing Performance Data402Average IO Size (Bytes/Sec)LSI storage systems The average input/out size (bytes/sec)Buffer Cache Hits Count per SecondNAS

Strany 381

HP Storage Essentials SRM 6.0 User Guide 403Bytes Received(MB/Sec)• Storage systems• Host (port for HBA card)• NAS filer (IP port)• Switch portNumber

Strany 382 - Event Management344

Viewing Performance Data404Disk Read (KB/second)Not available on HP-UX hosts because HP-UX hosts do not return read/write data separately.Disk drives

Strany 383

HP Storage Essentials SRM 6.0 User Guide 405File Read Percent Oracle Percentage of “reads” for the file against the total “reads” in the database.File

Strany 384 - Event Management346

Viewing Performance Data406Inode Cache Misses Count per SecondNAS filers (system) The number of inode cache misses per second.Invalid CRC Errors (erro

Strany 385 - Resetting a filter

HP Storage Essentials SRM 6.0 User Guide 407Name Cache Misses per SecondNAS filers The number of name cache misses per second on a NAS filer.Packets R

Strany 386 - Setting up advanced filtering

Viewing Performance Data408Physical Memory Used (%)Hosts The percentage of physical memory used on the host. To receive this data from a 64-bit AIX ho

Strany 387

HP Storage Essentials SRM 6.0 User Guide 409Redo Logspace Request RatioOracle The number of times lgwr had to wait for writing to redo the log file. I

Strany 388 - Event Management350

Viewing Performance Data410Tablespace Read PercentOracle Percentage of “reads” for the tablespace against the total “reads” in the database.Tablespace

Strany 389

HP Storage Essentials SRM 6.0 User Guide 411Managing Late Data or ErrorsIf you are performing real time data collection, and the element is not return

Strany 390

HP Storage Essentials SRM 6.0 User Guide 7• The type of license you have. Depending on your license, all features may not be available. See the List o

Strany 391

Viewing Performance Data412• The management server only monitors the top or bottom layer of Solstice Disksuite/Volume Manager. For example, assume you

Strany 392 - Event Management354

HP Storage Essentials SRM 6.0 User Guide 413Irix 6.5.x YIrix 6.5.x XVM YIrix 6.5.x CXFS Y (only on node sending I/O)Redhat 2.1 YRedhat 3.0 Sistina LV

Strany 393 - About Capacity Manager

Viewing Performance Data414Sudden Dips Displayed in Certain Charts in Performance ManagerIn Performance Manager and on the Monitoring tab, charts that

Strany 394

HP Storage Essentials SRM 6.0 User Guide 415The following charts for aggregate drives are impacted: ReadIOs, WriteIOs, TotalIOs, Bytes Transferred, Un

Strany 395 - Accessing Capacity Manager

Viewing Performance Data416

Strany 396

HP Storage Essentials SRM 6.0 User Guide 41714 Running ReportsDepending on your license, Reporter may not be available. See the List of Features to de

Strany 397

Running Reports418• Excel - The software displays the report in Microsoft Excel, providing you have a copy of Microsoft Excel already installed.• XML

Strany 398

HP Storage Essentials SRM 6.0 User Guide 419• Backup Manager - Data about backups, such as reports about the status of the daily backup, backup volume

Strany 399

Running Reports420Global Reports/System/Storage SystemGlobal Storage System Details by VendorShows the capacity summaries for all storage systems roll

Strany 400

HP Storage Essentials SRM 6.0 User Guide 421Chargeback Manager Asset-Based ChargebackA monthly chargeback report, listed by subsystem, that shows cost

Strany 401

Overview8• Policy Manager — Policy Manager can automatically send an e-mail, generate an event, or run a remote script when an element is being overus

Strany 402 - Viewing post-RAID information

Running Reports422System/Events Event Summary by DateShows incomplete events by severity over time. Incomplete events are the events that are not clea

Strany 403

HP Storage Essentials SRM 6.0 User Guide 423System/File Server Top N Aged Files Shows the list of Top N aged files based on the file accessed time sta

Strany 404 - Obtaining Utilization Reports

Running Reports424System/File Server Top N Volumes with Stale FilesShows the top N Volumes with stale files for each file server. System/File Server

Strany 405 - Viewing Capacity Charts

HP Storage Essentials SRM 6.0 User Guide 425System/Host Host Use of SAN Storage DetailsShows how external storage is being used by each host. System/H

Strany 406

Running Reports426System/Performance *EVA Storage Controller CPU UtilizationShows the CPU utilization for each controller. System/Performance *EVA Sto

Strany 407

HP Storage Essentials SRM 6.0 User Guide 427System/Performance *EVA Storage Pool ThroughputShows the throughput in MBs for the storage pool over time.

Strany 408

Running Reports428System/Storage System Storage Array Capacity by ApplicationsShows the capacity utilization by diiferent applications which have been

Strany 409 - 12 Managing Policies

HP Storage Essentials SRM 6.0 User Guide 429System/Switch Total Switch Port UtilizationShows used and free ports across all fabrics and switches.Backu

Strany 410 - Creating Policies

Running Reports430Backup Manager Restore SLA Summary Shows the Restore backup SLA summary details over time. Backup Manager SLA Summary Shows the back

Strany 411 - Severity Levels

HP Storage Essentials SRM 6.0 User Guide 431Hosts/ Asset Summary Shows the detailed asset information for a host.Hosts Dependency Shows all applicatio

Strany 412 - Managing Policies374

HP Storage Essentials SRM 6.0 User Guide 9• Discovery — This menu provides the tools for the management server to discover and obtain information from

Strany 413 - About the Policy Templates

Running Reports432NAS Details Shows the detailed configuration details of NAS storage. NAS Events Shows all non-cleared events received for the NAS st

Strany 414 - Managing Policies376

HP Storage Essentials SRM 6.0 User Guide 433*You will need to purchase an Array Performance Pack license to be able to see these reports. See ”About P

Strany 415

Running Reports434• In File System Viewer reports, file extensions may sometimes be truncated in reports. For example myfilename.txt may appear as myf

Strany 416 - Managing Policies378

HP Storage Essentials SRM 6.0 User Guide 435• Application Reports•Hosts Reports*•Storage System Reports*•Switch Reports**These reports display informa

Strany 417 - Creating Policies for Events

Running Reports436• Excel - The software displays the report in Microsoft Excel, providing you have a copy of Microsoft Excel already installed.• XML

Strany 418 - Modifying Policies

HP Storage Essentials SRM 6.0 User Guide 437yyyy-mm-dd hh:mm based on the 24-hour clock. There should be a space between the date and the time, as sho

Strany 419 - Modifying Discovery Policies

Running Reports438• XML - Display the report in the XML format.Opening a Report in a New WindowUse this feature to view two or more reports simultaneo

Strany 420 - Modifying Policies for Events

HP Storage Essentials SRM 6.0 User Guide 439If you do not see information in your reports, verify that you have global reporting set up correctly. See

Strany 421 - Viewing Policies

Running Reports4405. (Backup Manager reports only) Select the period of time you want displayed in the report by entering a start date and end date in

Strany 422 - Deleting Policies

HP Storage Essentials SRM 6.0 User Guide 441To add an e-mail schedule:1. Access Reporter as described in ”Accessing Reporter” on page 435.2. Expand th

Strany 423

Overview10IMPORTANT: You may not see all of the following utilities, depending on the role assigned to your user account. For example, users assigned

Strany 424 - Managing Policies386

Running Reports442• Monthly - If you select Monthly, select the time during the month you want the report sent:• To send the report on the first or la

Strany 425 - 13 Viewing Performance Data

HP Storage Essentials SRM 6.0 User Guide 443Editing an E-mail Schedule for a ReportIMPORTANT: Only the e-mail schedules created by the current user ar

Strany 426 - Software Requirements

Running Reports4443. When the report is displayed in the right pane, click the Scheduled Deliveries tab in the right pane.Information about the e-mail

Strany 427 - Specifying Data Collectors

HP Storage Essentials SRM 6.0 User Guide 445reports as you create them. Once you are satisfied with the customized reports, you can merge them onto th

Strany 428 - Viewing Performance Data390

Running Reports4461. Add the following class path to Report Designer. Refer to the documentation accompanying Report Designer for more information. C:

Strany 429

HP Storage Essentials SRM 6.0 User Guide 447If Report Designer cannot find the JDBC drivers, you may have entered incorrect path information.10.Select

Strany 430 - EVA Array Discovery

Running Reports4483. Click the Standard Report icon and then click Create to start the Report Form Creation Wizard.Figure 95 Choosing a Standard Repor

Strany 431 - EVAPerf Considerations

HP Storage Essentials SRM 6.0 User Guide 449not want all data displayed in the report. To find a definition of the listings in a table, see ”Detailed

Strany 432 - Creating Performance Charts

Running Reports450Refer to the online help for Report Designer for more information. When you finish selecting and linking materialized views, click N

Strany 433

HP Storage Essentials SRM 6.0 User Guide 4517. Enter search criteria that will be used to generate the report. For example, if you want the report to

Strany 434 - Viewing Performance Data396

HP Storage Essentials SRM 6.0 User Guide 11The Home PageThe Home page provides an overview of the main features for the management server. You can acc

Strany 435

Running Reports452the text in the AutoLabel column in the Report fields pane. To find a definition of the listings in a table, see ”Detailed Schema In

Strany 436 - Viewing Summary Charts

HP Storage Essentials SRM 6.0 User Guide 453For example, in the following figure, information in the report will first be sorted by an application nam

Strany 437

Running Reports45410.Use the Style tab to determine the layout of the report. When you are done, click Finish. Figure 101 Selecting the Layout of the

Strany 438 - Setting a Custom Period

HP Storage Essentials SRM 6.0 User Guide 455The report template is displayed. You will not see any data reported, only placeholders, as shown in the f

Strany 439 - Monitoring Options

Running Reports4565. Refer to the online help for Report Designer for information on how to design the report.Figure 103 Result of Clicking the View T

Strany 440 - Viewing Performance Data402

HP Storage Essentials SRM 6.0 User Guide 457The following screen displays.Figure 104 Manage Custom Reports ScreenThe screen lists these instructions t

Strany 441

Running Reports458After importing, a screen display similar to the following shows the imported report files. The imported reports can then be viewed

Strany 442 - Viewing Performance Data404

HP Storage Essentials SRM 6.0 User Guide 459report to the management server, and then you must integrate the report so that it is accessible from Repo

Strany 443

Running Reports460d. Make sure you use an ID that is not used by any of the existing reports. You must specify a title to appear in the tree and the f

Strany 444 - Viewing Performance Data406

HP Storage Essentials SRM 6.0 User Guide 461Table 60 Description of the Report ViewsMaterialized View(Tables)DescriptionMVC_ORGANIZATIONVW Provides in

Strany 445

HP Storage Essentials SRM 6.0 User Guide vObtaining SNMP Traps using Command View EVA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56Com

Strany 446 - Viewing Performance Data408

Overview12You may not see all of these features, depending on the following:• The type of license you have. Depending on your license, all features ma

Strany 447

Running Reports462MVCA_DBAPPCAPACITYVW Provides capacity information for a supported database application. See Table 92 on page 485.MVCA_EXCHANGEAPPCA

Strany 448 - Viewing Performance Data410

HP Storage Essentials SRM 6.0 User Guide 463MVC_HOSTDISKDRIVEVW Provides information about host disk drives. See Table 64 on page 467.MVC_HOSTVOLUMESU

Strany 449 - Managing Late Data or Errors

Running Reports464MVC_HOSTCAPACITYVW Provides host capacity information. See Table 78 on page 477.MVC_STORAGESYSTEMCONFIGVW Provides storage system co

Strany 450 - Viewing Performance Data412

HP Storage Essentials SRM 6.0 User Guide 465The following tables provide information about each report view:MVCA_FSRM_DIRREPORTDATAVW Provides informa

Strany 451

Running Reports466HOSTNAME VARCHAR2(256) Host NameDOMAINID NUMBER(38) DomainIDVENDOR VARCHAR2(256) Host VendorDESCRIPTION VARCHAR2(1024) Host Descript

Strany 452 - Aggregate Volumes

HP Storage Essentials SRM 6.0 User Guide 467Model VARCHAR2(256) Card modelSerialNumber VARCHAR2(256) Card Serial NumberVersion VARCHAR2(256) Card Vers

Strany 453

Running Reports468DiskPartition VARCHAR2(256) Disk Partition NameDiskPartitionDescription VARCHAR2(1024) Description of the partitionDiskPartitionSPac

Strany 454 - Viewing Performance Data416

HP Storage Essentials SRM 6.0 User Guide 469StoragePoolDescription VARCHAR2(1024) Description of the storage poolStatus NUMBER(38) Operational status

Strany 455 - 14 Running Reports

Running Reports470Table 67 MVC_STORAGEVOLUMESUMMARYVWColumn Name Type DescriptionStorageVolumeID NUMBER(38) StorageVolume IDStorageVolumeName VARCHAR2

Strany 456 - Running Reports418

HP Storage Essentials SRM 6.0 User Guide 471Description VARCHAR2(1024) Description of the SwitchStatus NUMBER(38) Operational status (provide map here

Strany 457

HP Storage Essentials SRM 6.0 User Guide 13Installing the Java Plug-in Java 2 Runtime Environment is required to access several features in the manage

Strany 458 - Running Reports420

Running Reports472Table 69 MVC_PORTSUMMARYVWColumn Name Type DescriptionPortID NUMBER(38) Port IDPortName VARCHAR2(256) Port NameDomainID NUMBER(38) D

Strany 459

HP Storage Essentials SRM 6.0 User Guide 473DominaID NUMBER(38) Domain ID (currently only one domain)CimClassName VARCHAR2(28)Status NUMBER(38) AppIQ

Strany 460 - Running Reports422

Running Reports474ZoneMemberName VARCHAR2(254) Name of the zone memberZoneMemberType VARCHAR2(254) Type of the zone memberZoneMemberInFabric NUMBER(1)

Strany 461

HP Storage Essentials SRM 6.0 User Guide 475HBAPortID NUMBER(38) HBA Port IDHostSwitchPortID NUMBER(38) ID of Host Switch PortSystemSwitchPortID NUMBE

Strany 462 - Running Reports424

Running Reports476Time_Reported DateSeverity NUMBER(38)Cleared NUMBER(1)Source VARCHAR2(254)Type NUMBER(38)SubType NUMBER(38)Probable_Cause_Descriptio

Strany 463

HP Storage Essentials SRM 6.0 User Guide 477DOMAINID NUMBER(38) Domain IDTable 77 MVC_ORGRELATIONVW (continued)Column Name Type DescriptionTable 78 MV

Strany 464 - Running Reports426

Running Reports478Table 80 MVC_STORAGEPOOLCONFIGVWColumn Name Type DescriptionStoragePoolID NUMBER(38) Storage Pool IDCollectionTime TIMESTAMP (6) Con

Strany 465

HP Storage Essentials SRM 6.0 User Guide 479Table 83 MVC_DISKEXTENTSUMMARYVWColumn Name Type DescriptionDiskExtentID NUMBER(38) Disk Extent IDDiskEnxt

Strany 466 - Running Reports428

Running Reports480Table 85 MVC_VOLUMEDISKDRIVEVWColumn Name Type DescriptionVolumeID NUMBER(38) Storage Volume IDDiskDriveID NUMBER(38) Disk Drive IDE

Strany 467

HP Storage Essentials SRM 6.0 User Guide 481Table 87 MVC_DISKDRIVESUMMARYVWColumn Name Type DescriptionDiskDriveID NUMBER(38) Disk Drive IDDiskDriveNa

Strany 468 - Running Reports430

Overview14Installing the Software Security CertificateTo stop receiving a Security Alert message each time you use the HTTPS logon, install the softwa

Strany 469

Running Reports482ContainerExtentID NUMBER Container Extent IDDiskID NUMBER Disk Drive IDTable 88 MVC_DISK_EXTENTVW (continued)Column Name Type Descri

Strany 470 - Running Reports432

HP Storage Essentials SRM 6.0 User Guide 483STORAGETIERCOSTPERGB NUMBER(36,2) Asset storage Tier costDEPARTMENTNO VARCHAR2(255) Asset department noD

Strany 471 - Troubleshooting Reporter

Running Reports484 RESELLER VARCHAR2(255) Asset Reseller COMMENTS VARCHAR2(4000) Comments ASSETFIXCOSTTAXPERDEPTPERYEAR NUMBER Asset Fixed cost tax

Strany 472 - Running Reports434

HP Storage Essentials SRM 6.0 User Guide 485Application Core ViewsTable 91 MVC_UNITACCESSVWColumn Name Type DescriptionID NUMBER(38)STORAGE_VOLUME_ID

Strany 473 - Viewing Reports

Running Reports486Table 93 MVCA_EXCHAPPCAPACITYVWColumn Name Type DescriptionExchangeAppID NUMBER(38)HostID NUMBER(38)CapacityType Varchar2(7)Timestam

Strany 474 - Report Parameters

HP Storage Essentials SRM 6.0 User Guide 487TotalDirectories NUMBER(38)TotalFiles NUMBER(38)DomainID NUMBER(38)Timestamp Timestamp(6)Table 95 MVCA_FSR

Strany 475 - Refreshing a Report

Running Reports488ParentKey NUMBER(38)DirName Varchar2(254)DirLSevel NUMBER(38)DirSize NUMBER(38)TotalSubDirectories NUMBER(38)TotalFiles NUMBER(38)Vo

Strany 476 - Running Reports438

HP Storage Essentials SRM 6.0 User Guide 489Contact Varchar2(254)Department Varchar2(254)Email Varchar2(254)Quota NUMBER(38)DomainID NUMBER(38)Table 1

Strany 477 - Sending a Report by E-mail

Running Reports490Table 103 MVCA_BU_MASTERSERVERSUMMARYColumn Name Type DescriptionMasterServerID NUMBER(38)MasterServerName Varchar2(256)HostID NUMBE

Strany 478 - Running Reports440

HP Storage Essentials SRM 6.0 User Guide 491Table 105 MVCA_BU_CLIENTSUMMARYColumn Name Type DescriptionClientID NUMBER(38)ClientName Varchar2(256)Mast

Strany 479

HP Storage Essentials SRM 6.0 User Guide 15Installing the Certificate by Using Firefox 1.51. Access the management server by entering the following:ht

Strany 480 - Running Reports442

Running Reports492Created DateAssigned DateLastMounted DateFisrtMounted DateExpirationDate DateNumberOfMounths NUMBERMaxMountsAllocated NUMBERDensity

Strany 481

HP Storage Essentials SRM 6.0 User Guide 493MasterServerID NUMBERClientID NUMBERBUJobID NUMBERJobState Varchar2(16)JobStatus Varchar2(16)ScheduleName

Strany 482 - Creating Custom Reports

Running Reports494Type Varchar2(64)RobotType Varchar2(64)RobotNumber NUMBERTotalNoOfSlots NUMBERTotalSlotsInUse NUMBERTotalNumberOfDrives NUMBERRobotD

Strany 483

HP Storage Essentials SRM 6.0 User Guide 495Table 111 MVC_DISCOVERYDETAILSVWName DescriptionElementID ID of the quarientiend elementElementName Name o

Strany 484 - Running Reports446

Running Reports496ObjectType Object typeTable 113 MVC_APPLICATIONRELATIONVWName DescriptionApplicationClusterID ID of the cluster applicationApplicati

Strany 485 - Designing Custom Reports

HP Storage Essentials SRM 6.0 User Guide 497Storagetype Type of storage Table 115 MVCA_BU_OPTIONALTABLEVWName DescriptionBasetableid ID of the basetab

Strany 486 - Running Reports448

Running Reports498ServerName Name of Exchange serverStoreID Store ID of the mailboxMailboxMessageSizeBytes Messages sizeUserMailBoxSizebytes Mailbox s

Strany 487

HP Storage Essentials SRM 6.0 User Guide 499CountofContacts Count of contacts in the mailboxCountofMessages Count of messagesAssociated_content_count

Strany 488 - Running Reports450

Running Reports500ApplicationID Application IDTable 121 MVCA_FSRM_FILEREPORTDATAVWName DescriptionVolumeid ID of FSRM volumeVolumename Name of volumeR

Strany 489

HP Storage Essentials SRM 6.0 User Guide 501Filename Name of the fileTotalsize Total size of fileAccesstime Timestamp of access timeCreatetime Timesta

Strany 490 - Running Reports452

Overview16IMPORTANT: The quotes in the example must be entered as left single quotes.2. Go to the following directory:<Install_Dir>/Toolswhere I

Strany 491

Running Reports502Freephysicalmemory Percentage of physical memory freePercentvirtualused Percentage of virtual memory usedFreevirtualmemory Percentag

Strany 492 - Running Reports454

HP Storage Essentials SRM 6.0 User Guide 503CPUPERCENTDATAXFERPERCENTDELTAREADIOSDELTAREADLATENCYDELTAWRITEIOSDELTAWRITELATENCYPCTREADIOSPCTWRITEIOSRE

Strany 493

Running Reports504AVGWRITESIZEDELTADRIVELATENCYDELTAREADIOSDELTAREADLATENCYDELTATOTALIOSDELTAWRITEIOSDELTAWRITELATENCYPCTREADIOSPCTWRITEIOSREADDATARAT

Strany 494 - Running Reports456

HP Storage Essentials SRM 6.0 User Guide 505DELTAREADIOSDELTAREADLATENCYDELTAWRITEIOSDELTAWRITELATENCYDISCARDFRAMESLINKFAILURELOSSOFSIGNALLOSSOFSYNCHP

Strany 495

Running Reports506AVGREADMISSLATENCYAVGREADSIZEAVGWRITELATENCYAVGWRITESIZEDELTAREADHITIOSDELTAREADHITLATENCYDELTAREADMISSIOSDELTAREADMISSLATENCYDELTAW

Strany 496 - Integrating Custom Reports

HP Storage Essentials SRM 6.0 User Guide 507Table 130 MVCS_EVASTORAGESYSTEMSTATSVWName DescriptionIDCOLLECTIONTIMESTATSTYPEDEVICETIMEDURATIONTOTALDATA

Strany 497

Running Reports508Views from Previous ReleasesIn this release, the materialized views were renamed, revised and in some cases removed. The following v

Strany 498 - Detailed Schema Information

HP Storage Essentials SRM 6.0 User Guide 509correctly against these new views. Some of the views have changed and may not work in existing reports. T

Strany 499

Running Reports510MV_LUNSPERFASUMMARYVW MVC_STORAGESYSTEMCONFIGVWMVC_STORAGESYSTEMSUMMARYVWMVC_STORAGEPROCESSORSUMMARYVWMVC_PORTSUMMARYVWMVC_PORTCONTR

Strany 500 - Running Reports462

HP Storage Essentials SRM 6.0 User Guide 511MV_TEMPHOSTLOGICALVW MVC_HOSTDISKDRIVEVWMVC_SUBPATHVWMVC_PATHVWMVC_HOSTVOLUMESUMMARYVWMVC_HOSTSUMMARYVWMVC

Strany 501

HP Storage Essentials SRM 6.0 User Guide 17IMPORTANT: Linux management servers require a fixed IP address for starting the appstormanager service.1. O

Strany 502 - Running Reports464

Running Reports512MV_HOSTVXVMVW MVC_DISKEXTENTSUMMARYVWMVC_HOSTSUMMARYVWMVC_DISK_EXTENTVWMVC_DISKDRIVESUMMARYVWMVC_OPTIONALTABLEVW, MVC_PATHVWMVC_SUBP

Strany 503

HP Storage Essentials SRM 6.0 User Guide 513MV_HOSTSSDEPENDECYVW MVC_HOSTSUMMARYVWMVC_SUBPATHVWMVC_STORAGEVOLUMESUMMARYVWMVC_STORAGESYSTEMSUMMARYVWMVC

Strany 504 - Running Reports466

Running Reports514MV_TEMPCONNECTEDSTORAGEVW MVC_PORTSUMMARYVWMVC_STORAGEPROCESSORSUMMARYVWMVC_STORAGESYSTEMSUMMARYVWMVC_SWITCHSUMMARYVWMVC_HOSTSUMMARY

Strany 505

HP Storage Essentials SRM 6.0 User Guide 515MV_DBAPPCHARGEBACKVW MVC_APPLICATIONSUMMARYVWMVCA_DBAPPINSTCAPACITYVWMVCA_DBAPPPHYCAPACITYVWMVCA_EXCHAPPCA

Strany 507

HP Storage Essentials SRM 6.0 User Guide 51715 Provisioning ManagerDepending on your license, Provisioning Manager may not be available. See the List

Strany 508 - Running Reports470

Provisioning Manager518About Provisioning Brocade Switches After UpgradingAfter you upgrade the management server, perform Discovery Data Collection f

Strany 509

HP Storage Essentials SRM 6.0 User Guide 519some network administrators prefer to put all of the Microsoft Windows computers in one zone and all of th

Strany 510 - Running Reports472

Provisioning Manager520Finance can access storage systems B and C but not storage system A. Likewise, users in Production can access storage systems A

Strany 511

HP Storage Essentials SRM 6.0 User Guide 521Use Table 133 on page 521 as a guideline for setting up zoning. Keep in mind the following:• If you use an

Strany 513

Provisioning Manager5221The ability to create, modify, and remove zone aliases, zones, and zone sets.2Also applies to EMC Connectrix switches.3Also ap

Strany 514 - Running Reports476

HP Storage Essentials SRM 6.0 User Guide 523• If a zone alias for a Sun StorEdge or QLogic switch is a member of an active zone, the zone alias is not

Strany 515

Provisioning Manager5242. In the right pane, click the SAN Zoning tab.3. Click the Provision button for the fabric on which you want to do provisionin

Strany 516 - Running Reports478

HP Storage Essentials SRM 6.0 User Guide 525Zone Naming ConventionsThe following naming conventions apply to zones, zone sets, and zone aliases:Naming

Strany 517

Provisioning Manager526NOTE: To select all of the ports, select the check box next to the Port heading. 7. Click OK.Deleting a Zone AliasYou cannot de

Strany 518 - Running Reports480

HP Storage Essentials SRM 6.0 User Guide 527Qlogic1:zone_name displayed under the Name column. Qlogic1 is the name of the switch, and zone_name is the

Strany 519

Provisioning Manager528• You cannot create a zone with an existing name. • A port is not in the virtual SAN if the icon is next to it. 10.Click OK.A

Strany 520 - Running Reports482

HP Storage Essentials SRM 6.0 User Guide 529• For more information about which zoning features are supported for your switches, see Table 134 on page

Strany 521

Provisioning Manager5301. Click Tools > Storage Essentials > Provisioning Manager in HP Systems Insight Manager.2. In the right pane, click the

Strany 522 - Running Reports484

HP Storage Essentials SRM 6.0 User Guide 5318. Click OK.Deleting a Zone SetThe software does not display all elements in a zone set, such as quick loo

Strany 523

HP Storage Essentials SRM 6.0 User Guide 192 Discovering Switches, StorageSystems, NAS Devices, and Tape LibrariesBefore you can use the management se

Strany 524 - Running Reports486

Provisioning Manager532IMPORTANT: This feature is supported only for switches that support zone set copying. Refer to Table 134 on page 521 for inform

Strany 525

HP Storage Essentials SRM 6.0 User Guide 533b. Optional: In the Name box, modify the name that has been assigned to the backup zone set. The managemen

Strany 526 - Running Reports488

Provisioning Manager534If a user activates ZoneSetB, the existing information in ZoneSetB is copied to the switch and activated. The Zoning Library, h

Strany 527

HP Storage Essentials SRM 6.0 User Guide 5351. Select Options > Storage Essentials > Manage Product Health, and then click Advanced in the Disk

Strany 528 - Running Reports490

Provisioning Manager536Managing StorageThis section contains the following topics:• Setting Up Storage Partitioning, page 536• Modifying the Cache Set

Strany 529

HP Storage Essentials SRM 6.0 User Guide 5371The “Create Pool Using Settings” column refers to the functionality that lets you choose the type of pool

Strany 530 - Running Reports492

Provisioning Manager538CLARiiON Y Y Y Y RAID level can be specified for first volume in a pool, subsequent volumes inherit this setting.LSI and Sun 61

Strany 531

HP Storage Essentials SRM 6.0 User Guide 539HP MSA Y N N YIBM DSY N N Y See ”Additional Information About IBM DSS and IBM ESS” on page 540IBM ESS Y N

Strany 532 - Running Reports494

Provisioning Manager540Additional Information About CLARiiON Storage SystemsThe EMC Navisphere® CLI is required to communicate with the CLARiiON stora

Strany 533

HP Storage Essentials SRM 6.0 User Guide 541• Issues Specific to LSI Storage Systems, page 569How to Set Up Storage PartitioningTo set up storage part

Strany 534 - Running Reports496

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries20About DiscoveryWhen HP Storage Essentials is integrated with HP SIM, Discovery

Strany 535

Provisioning Manager5421. Click the Edit ( ) button for the volume you want to modify. 2. Enter the cache read ahead multiplier (0 to 65535 bytes) in

Strany 536 - Running Reports498

HP Storage Essentials SRM 6.0 User Guide 543Creating a Storage Pool (LSI, CLARiiON, Sun 6130 and Sun 35xx)A storage pool is a group of disks associate

Strany 537

Provisioning Manager544•Volumes - Click the name of the volume to view its properties. If the storage system has a large number of volumes, not all th

Strany 538 - Running Reports500

HP Storage Essentials SRM 6.0 User Guide 545• Creating a Storage Volume, page 547• Deleting a Storage Volume, page 550• Changing the Cache Block Size

Strany 539

Provisioning Manager546To create a volume, click the New Volume button in the upper-right corner of the page. To delete several volumes at once, selec

Strany 540 - Running Reports502

HP Storage Essentials SRM 6.0 User Guide 547to the storage system until the volume is mapped to a port. As a result, they are referred to as Groups. F

Strany 541

Provisioning Manager548operations. So if you want to create a LUSE volume and then perform LUN creation on the HDS box, it is a two-step process. Firs

Strany 542 - Running Reports504

HP Storage Essentials SRM 6.0 User Guide 549NOTE: You can also access the Create Storage Volume wizard from the Navigation tab in System Manager. To a

Strany 543

Provisioning Manager550• Database - Provides a cache read ahead multiplier of 0 with a segment size of 64 KB.• Multimedia - Provides a cache read ahea

Strany 544 - Running Reports506

HP Storage Essentials SRM 6.0 User Guide 5517. When you are asked if you want to delete the volume, click OK.8. To delete several storage volumes at o

Strany 545

HP Storage Essentials SRM 6.0 User Guide 21Note the following:• Storage systems managed by HP Storage Essentials show a subtype of Storage Essentials

Strany 546 - Views from Previous Releases

Provisioning Manager55211.Click OK.Rules for Creating Host Security GroupsThis section contains the following topics:• ”Host Security Groups on EMC CL

Strany 547

HP Storage Essentials SRM 6.0 User Guide 553NOTE: For the Volume Creation and LUN Security option in Path Provisioning, the All Ports node is not show

Strany 548 - Running Reports510

Provisioning Manager554• When creating a host security group, if you provide a volume, but not an initiator, the host security group is created, but t

Strany 549

HP Storage Essentials SRM 6.0 User Guide 555Host Security Groups on HP MSA Storage SystemsKeep in mind the following rules for host security groups on

Strany 550 - Running Reports512

Provisioning Manager556• The management server can read the names of host security groups created by the native tool.• Creation of a new host security

Strany 551

HP Storage Essentials SRM 6.0 User Guide 5572. In the right pane, click the Storage Systems tab. 3. Click the Provision button for the storage system

Strany 552 - Running Reports514

Provisioning Manager558• - Move back one page.• - Move forward one page. • - Move to the last page.You can also create, edit and delete host securi

Strany 553

HP Storage Essentials SRM 6.0 User Guide 559NOTE: You cannot name a host security group on IBM storage systems. The host security group will be given

Strany 554 - Running Reports516

Provisioning Manager5605. To remove an initiator from the host security group, click the Delete ( ) button. To remove multiple HBA initiators from the

Strany 555 - 15 Provisioning Manager

HP Storage Essentials SRM 6.0 User Guide 561NOTE: Each type of storage system handles ports for host security groups differently. For more information

Strany 556 - Managing Zones

viViewing the Status of System Tasks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75Using Discovery Groups .

Strany 557

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries224. A host containing a Host Bus Adapter (HBA). All Fibre Channel host bus adap

Strany 558 - Provisioning Manager520

Provisioning Manager562• If you want to choose a unit number, deselect the Auto-Select option and enter the unit number in the Unit Number box at the

Strany 559

HP Storage Essentials SRM 6.0 User Guide 5632. Click Show Default Properties at the bottom of the page.3. Copy smi.ProvisioningIbmEss.hostConnectionPr

Strany 560 - Provisioning Manager522

Provisioning Manager564Issues Specific to CLARiiON Storage SystemsThe following issues are specific to CLARiiON® storage systems:• Making the Manageme

Strany 561

HP Storage Essentials SRM 6.0 User Guide 565About Provisioning on EMC Symmetrix Storage SystemsEMC ships its Symmetrix storage system with volumes alr

Strany 562 - Creating a Zone Alias

Provisioning Manager566Issues Specific to HDS Storage SystemsThis section contains the following topics:• About Provisioning on HDS Storage Systems, p

Strany 563 - Modifying a Zone Alias

HP Storage Essentials SRM 6.0 User Guide 567In build 5.0, the management server uses the nickname attribute when it’s available. If you want to update

Strany 564 - Deleting a Zone Alias

Provisioning Manager568group, but the target host security group is deleted when the first command is completed, and the second command returns an err

Strany 565 - Creating a Zone in a Fabric

HP Storage Essentials SRM 6.0 User Guide 569Cannot Always Delete Selected Volume on MSAMSA volumes must be deleted in the reverse order of their creat

Strany 566 - Deleting a Zone

Provisioning Manager570NOTE: No volume-to-LUN masking is done by default.IMPORTANT: The management server creates a placeholder volume when a storage

Strany 567 - Creating a Zone Set

HP Storage Essentials SRM 6.0 User Guide 57116 Managing BackupsDepending on your license, the Backup Manager feature may not be available. See the Lis

Strany 568 - Modifying a Zone Set

HP Storage Essentials SRM 6.0 User Guide 23example, in the phased discovery described in ”Discovering Elements” on page 27, you could discover your sw

Strany 569 - Copying a Zone Set

Managing Backups572• Media Manager Application — A backup application functioning as a server to control the media in a backup hierarchy. A media mana

Strany 570 - Activating a Zone Set

HP Storage Essentials SRM 6.0 User Guide 573IMPORTANT: Make sure you have at least 500 MB available if you are using the host as a backup manager host

Strany 571

Managing Backups574• Allocated — The media is currently either actively being used or has a valid backup on it.• Frozen — The media will never become

Strany 572

HP Storage Essentials SRM 6.0 User Guide 575• Session Status — The session status: Success or Failure• Session State — The session state: Done, Queued

Strany 573

Managing Backups5761. Access Backup Manager by clicking Tools > Storage Essentials > Backup Manager or by clicking Tools > Storage Essentials

Strany 574 - Managing Storage

HP Storage Essentials SRM 6.0 User Guide 577period for the coverage and review the policy, schedule, and results for the backups executed for that per

Strany 575

Managing Backups578To access the backup reports:1. Access Reporter by clicking Reports > Storage Essentials > Manage Reports or clicking Tools &

Strany 576 - Provisioning Manager538

HP Storage Essentials SRM 6.0 User Guide 579About the Toolbars in Backup Manager Backup Manager has two toolbars.• The main toolbar that appears at th

Strany 577

Managing Backups580Allows you to move an element in the topology. See ”Arranging Elements in the Topology” on page 274. Enabled when the Topology tab

Strany 578 - Provisioning Manager540

HP Storage Essentials SRM 6.0 User Guide 581About the Toolbar for ChartsThe toolbar options described in Table 140 on page 581 are only available when

Strany 579

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries24Configuring the HP SIM Connector to Pass Devices with the DNS Name (Optional)B

Strany 580 - Managing Storage Pools

Managing Backups582Changing the Topology Settings The Display Layout Settings Dialog ( ) button allows you to modify the following properties of the t

Strany 581

HP Storage Essentials SRM 6.0 User Guide 5832. Click Export to Visio.3. Name the file, and then select the directory in which you want the file to be

Strany 582 - Managing Volumes

Managing Backups584Update Element Data The management server gathers new and changed details from the element and then redraws the topology with the u

Strany 583

HP Storage Essentials SRM 6.0 User Guide 585The charts in Backup Manager provide a wealth of information about your backups. You can obtain detailed i

Strany 584 - Filtering Volumes

Managing Backups586Table 143 on page 586 explains what is displayed when you click Show Details on the Summary tab’s right-click menu option.NOTE: Whe

Strany 585 - Creating a Storage Volume

HP Storage Essentials SRM 6.0 User Guide 587About the Summary Backup Charts Backup Manager displays six summary backup charts on the Summary tab by de

Strany 586 - Provisioning Manager548

Managing Backups588About the Tabs in the Topology Lower Pane The lower pane on the Topology tab is displayed when you select a discovered backup eleme

Strany 587

HP Storage Essentials SRM 6.0 User Guide 589Table 146 Tabs in the Lower Pane of Backup Manager Topology Tab Element Type DescriptionProperties All el

Strany 588 - Deleting a Storage Volume

Managing Backups590Resources • Backup Manager Hosts• Media Managers• Tape LibrariesDisplays the resources Backup Manager monitors with the following f

Strany 589

HP Storage Essentials SRM 6.0 User Guide 591Sorting Information in the Lower PaneYou can sort the information displayed on the tabs in the lower pane

Strany 590 - Provisioning Manager552

HP Storage Essentials SRM 6.0 User Guide 25• Do not run the initial discovery process at the end of the wizard. See the HP Systems Insight Manager Use

Strany 591

Managing Backups592can be extremely useful. For example, if you have several clients with failed backups, you would take the following steps to sort t

Strany 592 - Provisioning Manager554

HP Storage Essentials SRM 6.0 User Guide 593To modify a chart displayed on the Summary tab in Backup Manager:1. Access Backup Manager as described in

Strany 593

Managing Backups5941. Access a backup summary chart by clicking an element on the Topology tab. 2. Scroll to the bottom of the screen.3. Click the Pri

Strany 594 - Managing Host Security Groups

HP Storage Essentials SRM 6.0 User Guide 59517 Path ProvisioningDepending on your license, Path Provisioning may not be available. See the List of Fea

Strany 595

Path Provisioning596• Changes from executed jobs. After a job is executed in Path Provisioning, the Path Provisioning screen is not updated until you

Strany 596 - Creating Host Security Groups

HP Storage Essentials SRM 6.0 User Guide 597• Only manageable fabrics will be displayed in the Path Provisioning. If no provisioning can be done on th

Strany 597

Path Provisioning598The status of each job is displayed in the State column of the Provision Job section located in the lower pane of the screen. A jo

Strany 598 - Editing a Host Security Group

HP Storage Essentials SRM 6.0 User Guide 599NOTE: You can control which templates users can access. See ”Assigning a Template to a Role” on page 636 f

Strany 599

Path Provisioning600Default System Action TemplatesThis section describes the contents of the default system action templates and the options included

Strany 600 - Provisioning Manager562

HP Storage Essentials SRM 6.0 User Guide 601• If you have options still selected from a previous job, clear the options you do not want in your next j

Strany 601 - Provisioning Issues by Vendor

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries26The Discovery Setup, Step 1 - Setup page shows the HP Storage Essentials manag

Strany 602

Path Provisioning602The selected storage system’s name is displayed below the Storage System pane. The Host pane is populated. Notice in the figure be

Strany 603

HP Storage Essentials SRM 6.0 User Guide 603• Loading zone data finished.The Step 2 button is disabled until data has been loaded2. Select a host that

Strany 604 - Provisioning Manager566

Path Provisioning604key on your keyboard and selecting free LDEVS. When you select free extents, they must of the same type. For example, on Symmetrix

Strany 605 - LUSE"

HP Storage Essentials SRM 6.0 User Guide 605• To create a zone - Select a fabric in the zone pane, click the button, and then enter a name for the z

Strany 606 - =3600000

Path Provisioning606• To clear the action taken in all Steps except Step 1, select another option from the System Action combo-box.• HDS only: Before

Strany 607

HP Storage Essentials SRM 6.0 User Guide 607When you first discover a storage system, no free extents are displayed. This is because the management se

Strany 608 - Provisioning Manager570

Path Provisioning6082. Select the storage system on which you want to create the metavolume.NOTE: The S column heading in the Storage Systems pane mea

Strany 609 - 16 Managing Backups

HP Storage Essentials SRM 6.0 User Guide 609• If you select hosts and storage ports that are not contained in an existing zone alias, the new hosts an

Strany 610 - Managing Backups572

Path Provisioning610IMPORTANT: Make sure the added host is physically connected to the network before the scheduled job runs.1. Click the button.2.

Strany 611

HP Storage Essentials SRM 6.0 User Guide 611Keep in mind the following:• You can narrow the type of volumes displayed in the Volumes pane by using the

Strany 612 - Accessing Backup Manager

HP Storage Essentials SRM 6.0 User Guide 27e. In the WBEM settings section, select Update values for this protocol and Use values specified below. f.

Strany 613

Path Provisioning612NOTE: The S column heading in the Storage Systems pane means that only a single selection is allowed.3. Click the Step 1 button be

Strany 614 - Managing Backups576

HP Storage Essentials SRM 6.0 User Guide 6131. Wait for all data to be loaded. When all data has been loaded, the following messages are displayed.:•

Strany 615 - Viewing Backup Reports

Path Provisioning614Step 3 - Select a ZoneNOTE: If the zone has already been selected and Step 5 is clicked, skip this step or click the button to c

Strany 616 - About the User Interface

HP Storage Essentials SRM 6.0 User Guide 615• If you want the job to execute now, click the Execute Job () button• If you want the job to execute at a

Strany 617

Path Provisioning616The selected storage system’s name is displayed below the Storage System pane.Figure 112 Selecting a Storage SystemStep 2 - Select

Strany 618 - Managing Backups580

HP Storage Essentials SRM 6.0 User Guide 617type. For example, on Symmetrix, you cannot select a mirrored volume and a BCV (business continuous volume

Strany 619

Path Provisioning618• If you have options still selected from a previous job, clear the options you do not want in your next job. For example, assume

Strany 620 - Managing Backups582

HP Storage Essentials SRM 6.0 User Guide 619The selected storage system’s name is displayed below the Storage System pane. The Host pane is populated.

Strany 621

Path Provisioning620The Step 2 button is disabled until data has been loaded2. Take one of the following actions:• Select a host that is accessible.•

Strany 622 - Managing Backups584

HP Storage Essentials SRM 6.0 User Guide 6215. Repeat Steps 2 and 3 for multiple ports.6. If you want to remove the host, click the button.7. When y

Strany 623

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries28IMPORTANT: For best results, enter only global credentials that apply to the s

Strany 624 - Managing Backups586

Path Provisioning622IMPORTANT: (McDATA switches only) Path Provisioning looks for the names of the active zone set and of the active zones and verifie

Strany 625

HP Storage Essentials SRM 6.0 User Guide 623You can assign a volume to existing host security groups, as described in the following steps.1. Click Too

Strany 626 - Managing Backups588

Path Provisioning624Step 2 - Select a VolumeTo select a volume:1. In the Volume pane select mapped and unmapped volumes. You can select multiple volum

Strany 627

HP Storage Essentials SRM 6.0 User Guide 625Step 3 - Select a Host Security Group1. Select a host security group in the LUN pane. See ”Creating a Host

Strany 628 - Managing Backups590

Path Provisioning6262. In the right pane, click Start Here on the Path Provisioning tab.3. Click the Configure Templates button at the top of the scre

Strany 629

HP Storage Essentials SRM 6.0 User Guide 6276. Click Apply.7. When you are done, take one of the following actions:•Click Apply if you want to apply y

Strany 630 - Managing Backups592

Path Provisioning6283. Select a host in the Host pane.4. Click Step 2.5. Select a port in the LUN pane.6. Click at the top of the LUN pane.7. When y

Strany 631 - Printing Summary Charts

HP Storage Essentials SRM 6.0 User Guide 629To schedule a provisioning job:1. Click the Create Job button in the lower pane.The job is assigned the “c

Strany 632 - Managing Backups594

Path Provisioning630Executing Provisioning JobsIf you want to save and execute a job, you must click the Execute Job ( ) button. When you click that b

Strany 633 - 17 Path Provisioning

HP Storage Essentials SRM 6.0 User Guide 631• The name is case sensitive. For example, “Zone1” and “zone1” are different zones.• You cannot create a z

Strany 634 - Path Provisioning596

HP Storage Essentials SRM 6.0 User Guide 2911.Select the discovery task created in step 4, and then click Run Now.When complete, the task monitor show

Strany 635 - How Path Provisioning Works

Path Provisioning632To narrow the types of volumes displayed in the Volume pan, set the Customize Volume Options dialog box. The Customize Volume Opti

Strany 636 - How to Use Path Provisioning

HP Storage Essentials SRM 6.0 User Guide 633Customize Volume Options Dialog BoxNOTE: The Customize Volume Options dialog box is not available for the

Strany 637

Path Provisioning634identical zone contains only the same HBA and storage system ports you selected. If the zone contains additional members, it is no

Strany 638 - Path Provisioning600

HP Storage Essentials SRM 6.0 User Guide 6354. Select a storage system, and click Step 1. 5. Select a host, and click Step 2. One of the following occ

Strany 639

Path Provisioning636Assigning a Template to a RoleYou can assign templates to a role to restrict a user’s access to all templates. For example, you co

Strany 640 - Step 2 - Select a Host

HP Storage Essentials SRM 6.0 User Guide 63718 Chargeback ManagerDepending on your license, Chargeback Manager may not be available. See the List of F

Strany 641 - Step 3 - Select a Volume

Chargeback Manager638First set up your chargeback as described in the topic, ”Setting Up Chargeback Manager” on page 638. When you are done with addin

Strany 642 - Step 5 - Select a Zone

HP Storage Essentials SRM 6.0 User Guide 639Accessing Chargeback ManagerTo access Chargeback Manager, do one of the following:•Select Tools > Stora

Strany 643 - Creating a Meta Volume

Chargeback Manager640the management server cannot obtain detailed information about the element. If you create a record for an application, that appli

Strany 644 - Path Provisioning606

HP Storage Essentials SRM 6.0 User Guide 641• In Use - The element is running.The status settings are set manually. For example, if the status of an e

Strany 645 - LUN Security

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries30Discovery process. For more information on switch support, see the support mat

Strany 646

Chargeback Manager6421. To remove an asset record, click the Delete ( ) button corresponding to the record you want to remove. Defining Storage TiersT

Strany 647

HP Storage Essentials SRM 6.0 User Guide 643Creating a New Storage TierYou can create you own storage tiers (up to a maximum of 64).Follow these steps

Strany 648

Chargeback Manager644Removing Elements from a Storage TierFollow these steps to remove elements from a storage tier:1. Access the Add or Remove Storag

Strany 649 - Zone Operation

HP Storage Essentials SRM 6.0 User Guide 645Adding Asset InformationChargeback Manager provides a handy way for you to keep track of your asset inform

Strany 650

Chargeback Manager646NOTE: This page enforces the maximum number of characters you can enter in a box. When you can no longer add additional character

Strany 651

HP Storage Essentials SRM 6.0 User Guide 647• Staff #2 Name - The name of an additional person who maintains the element.• Staff #2 Phone Number - A p

Strany 652 - Step 3 - Select a Zone

Chargeback Manager648Managing DepartmentsThis section contains the following topics:• Adding Departments, page 648• Editing a Department, page 648• Re

Strany 653

HP Storage Essentials SRM 6.0 User Guide 649For example, assume you want to delete a department called TooSmall. The TooSmall department owns 50 perce

Strany 654 - Step 2 - Select a Volume

Chargeback Manager650• Setting Up Asset-Based Chargeback Manager, page 650• Setting Up Storage-Based Chargeback Manager, page 653• Editing Percentage

Strany 655

HP Storage Essentials SRM 6.0 User Guide 651Step 1 - Specify Financial information1. Verify that the option Step 1 - Specify Financial information is

Strany 656 - Path Provisioning618

HP Storage Essentials SRM 6.0 User Guide 31periodically to verify that you are running a current version of the Brocade SMI Agent. For more informatio

Strany 657

Chargeback Manager6521. Select the option Step 2 - Assign Departmental Ownership Percentage at the top of the page.2. Click Add Ownership. 3. Select a

Strany 658 - Path Provisioning620

HP Storage Essentials SRM 6.0 User Guide 653IMPORTANT: The infrastructure cost is not included in ownership cost because the information displayed on

Strany 659 - Step 4 - Select a Zone

Chargeback Manager654NOTE: You can also access the tree from Application Viewer and System Manager.• To access the tree from Application Viewer, click

Strany 660 - Volume Assignment

HP Storage Essentials SRM 6.0 User Guide 655Step 3 - Review Storage Dependency and CostIMPORTANT: The management server displays chargeback informatio

Strany 661

Chargeback Manager6566. In the Ownership % box, enter a new percentage of ownership. 7. Click Save Changes. Removing Department Ownership of an Elemen

Strany 662

HP Storage Essentials SRM 6.0 User Guide 657MB to gigabytes (0.887 GB) and round the output (0.89 GB), the capacity in Capacity Manager matches the nu

Strany 663 - Providing a LUN Number

Chargeback Manager658Example: Using the examples from the previous two steps, the delta is 12 months (January 1, 2003 through December 31, 2003).4. It

Strany 664 - Path Provisioning626

HP Storage Essentials SRM 6.0 User Guide 6593. The management server takes the user-specified depreciation period and use it as the life of the asset.

Strany 665 - Adding a Host

Chargeback Manager660Step 5a - Assume the asset value of the element is $2395. Calculate the "would-be" depreciation of the month by multipl

Strany 666 - Scheduling Provisioning Jobs

HP Storage Essentials SRM 6.0 User Guide 661Example: Use the example from step 4 (24 months) in the following formula to find the rate of depreciation

Strany 667

HP Storage Essentials SRM 6.0 User Guide viiStep A — Import the Wrapper Class Definitions into the Caché Instance . . . . . . . . . . . . . 115Step

Strany 668 - Naming Conventions

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries32This document is written for an earlier version of the Brocade SMI Agent, but

Strany 669

Chargeback Manager662Step 6b - Assume the salvage value is $100. Determine if the asset value after depreciation is less than the salvage value by usi

Strany 670 - Customizing Path Provisioning

HP Storage Essentials SRM 6.0 User Guide 663Viewing Chargeback by Department You can determine how much a department is being charged for equipment us

Strany 671 - Customize HSG Options

Chargeback Manager664Viewing Chargeback by Owner You can view chargeback for all elements by using the Ownership tab. The Ownership tab shows the owne

Strany 672 - Path Provisioning634

HP Storage Essentials SRM 6.0 User Guide 665Chargeback ReportsThis section contains the following topics:• Viewing Chargeback Reports, page 665• E-mai

Strany 673 - Manually Configure Zoning

Chargeback Manager6664. To view the report in a new window, select the Open in new window option, and then click Run Report. E-mailing a Chargeback Re

Strany 674 - Path Provisioning636

HP Storage Essentials SRM 6.0 User Guide 667• Viewing the History of an E-mail Chargeback Schedule, page 671Adding an E-mail Schedule for a Chargeback

Strany 675 - 18 Chargeback Manager

Chargeback Manager668If you are e-mailing reports in bulk, you might want to let users know the e-mail is being sent by an automated process. You migh

Strany 676 - Chargeback Manager638

HP Storage Essentials SRM 6.0 User Guide 669Editing an E-mail Schedule for a Chargeback Report IMPORTANT: Only the e-mail schedules created by the cur

Strany 677 - Creating an Asset Record

Chargeback Manager670Deleting E-mail Schedules for a Chargeback ReportIMPORTANT: Only the e-mail schedules created by the current user are listed. To

Strany 678 - Chargeback Manager640

HP Storage Essentials SRM 6.0 User Guide 671Information about the e-mail schedules for that report are displayed, as described in Table 156 on page 67

Strany 679 - Viewing Assets

HP Storage Essentials SRM 6.0 User Guide 335. Run Discovery Data Collection. See the chapter, “Discovering Switches, Storage Systems, NAS Devices, and

Strany 680 - Defining Storage Tiers

Chargeback Manager6724. When the report is displayed in the right pane, click the Scheduled Deliveries tab in the right pane.5. Under the History colu

Strany 681 - Creating a New Storage Tier

HP Storage Essentials SRM 6.0 User Guide 673ready for your changes to take effect. Chargeback Manager displays only the elements you specified in your

Strany 682 - Adding Asset Information

Chargeback Manager674ready for your changes to take effect. Chargeback Manager displays only the elements you specified in your filter.Customizing the

Strany 683 - Adding General Information

HP Storage Essentials SRM 6.0 User Guide 67519 Business ToolsDepending on your license, Business Tools may not be available. See the List of Features

Strany 684 - Adding Staff Information

Business Tools676Only Discovery Data Collection removes elements that are no longer there from the user interface. For example, removed ports could ap

Strany 685 - Adding Custom Information

HP Storage Essentials SRM 6.0 User Guide 677Installing New HBA with Old HBATo install the new HBA with the old HBA:1. Install the new HBA with the old

Strany 686 - Managing Departments

Business Tools678Let's expand that analysis to verifying that those HBA's also have a certain driver version and a certain firmware level, a

Strany 687

HP Storage Essentials SRM 6.0 User Guide 679• 1002 is the element ID.Comparing a Previous Configuration by Using Global Change ManagementNOTE: Global

Strany 688 - Chargeback Manager650

Business Tools680it is done, it lists the changes under the heading CHANGED PROPERTIES on the screen.The following sample output displays the analyzed

Strany 689

HP Storage Essentials SRM 6.0 User Guide 681Host _1750...Host _1739...Switch clbrocade3...Host _1732...Host COLO-WINHOST2...Host _1717...StorageSystem

Strany 690 - Chargeback Manager652

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries34•If you selected No in the Brocade SMI Agent Enabling Security window, you can

Strany 691

Business Tools682 NEW DiskPartition Disk #6, Partition #2 NEW DiskDrive 6005076303ffc640000000000000110f:c0t1d4p4 NEW DiskDrive 6

Strany 692 - Chargeback Manager654

HP Storage Essentials SRM 6.0 User Guide 683 NEW LogicalDisk M: NEW HostTargetMapping_1025 NEW HostTargetMapping_1042 NEW

Strany 693

Business Tools684

Strany 694 - Chargeback Manager656

HP Storage Essentials SRM 6.0 User Guide 68520 TroubleshootingHP Storage Essentials Standard Edition supports a subset of the devices supported by Ent

Strany 695

Troubleshooting686• Increasing the time-out for the HP SIM Connector, page 689• Storage Essentials Menus Are Not Shown in HP SIM, page 690• NoSuchElem

Strany 696 - Chargeback Manager658

HP Storage Essentials SRM 6.0 User Guide 687Checking Installation Log Files • The following log files are generated by the installer and can be found

Strany 697 - $2500 x .042 = $105

Troubleshooting688“SEVERE: OUI-10029...” MessageThe installation wizard lets you specify an installation location for Oracle 10g. If you specify a loc

Strany 698 - $2294.41

HP Storage Essentials SRM 6.0 User Guide 6891. Enter the following at the command prompt, where mycomputer is the shortened DNS name of the machine:ns

Strany 699 - $2290 x .084 = $192.36

Troubleshooting690<admin-user>management-server-domain\administrator</admin-user> <SIM-on-windows>true</SIM-on-windows>

Strany 700 - Viewing Chargeback

HP Storage Essentials SRM 6.0 User Guide 691IMPORTANT: Do not install the Oracle database separately, the management server Installation Wizard (or Un

Strany 701 - (Ownership %))

HP Storage Essentials SRM 6.0 User Guide 35b. Make the following entry in the file:cimomenabled=TRUEc. Save the file, and then restart the InVsn softw

Strany 702 - Viewing Chargeback by Owner

Troubleshooting6921. Stop the AppStorManager service, which is the service the management server uses.NOTE: While the service is stopped, the manageme

Strany 703 - Chargeback Reports

HP Storage Essentials SRM 6.0 User Guide 693Unix systemsTo verify the Oracle service has started, enter the following at the command prompt:# ps -ef |

Strany 704 - Chargeback Manager666

Troubleshooting694Permanently Changing the Port a CIM Extension Uses (UNIX Only)CIM extensions on UNIX use port 4673 by default. You can start a CIM e

Strany 705

HP Storage Essentials SRM 6.0 User Guide 695• The “If Mentioned in cim.extension.parameters” column provides information on how you would modify the c

Strany 706 - Chargeback Manager668

Troubleshooting696With 3 firewall ports opened on different ports respectively 1234, 5678, 9012.start -on 10.250.250.10:1234-on 172.31.250.10: 5678-on

Strany 707

HP Storage Essentials SRM 6.0 User Guide 697With firewall port 1234 opened between a host and management server. NAT environment where 10.250.250.10

Strany 708 - Chargeback Manager670

Troubleshooting698Volume Names from Ambiguous Automounts Are Not DisplayedVolume names from ambiguous automounts on Solaris hosts are not displayed on

Strany 709

HP Storage Essentials SRM 6.0 User Guide 699The following example is a comma-separated string that is part of a mounted volume name. The management se

Strany 710 - Filtering Assets

Troubleshooting700The security certificate has a valid name matching the name of the page you are trying to view.When you change the certificate, you

Strany 711 - Filtering Assets by Status

HP Storage Essentials SRM 6.0 User Guide 701NOTE: If you see an error message when you enter this command, a previous certificate may not have been cr

Strany 712 - Chargeback Manager674

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries36• Enable the CIM Server for Cisco switches discovered through the SMI-S provid

Strany 713 - 19 Business Tools

Troubleshooting702• A Discovered Sun StorEdge A5000 JBOD Does Not Display Its WWN Properly, page 714• Unable to Monitor McDATA Switches, page 714• Una

Strany 714 - %CLI_DIR%\cli\bin

HP Storage Essentials SRM 6.0 User Guide 703• HBA (Driver Version)• MultipathingUnable to discover Emulex host bus adaptersThe Emulex driver does not

Strany 715 - Setting up Risk Analysis

Troubleshooting704The status reports for Discovery Data Collection are sent as follows:• gaedemail property is empty - The e-mail is sent to users who

Strany 716 - Global Change Management

HP Storage Essentials SRM 6.0 User Guide 7058. To modify the time-out period, set the corresponding property for your switch in the following table to

Strany 717

Troubleshooting706“Connection to the Database Server Failed” ErrorIf you received an error message resembling the following after getting all element

Strany 718

HP Storage Essentials SRM 6.0 User Guide 707Duplicate Listings/Logs for Brocade Switches in Same FabricDuplicate listings: Targets tabIf you discover

Strany 719

Troubleshooting708Element Logs Authentication Errors During DiscoveryDuring discovery, you may see SNMP authentication errors on the element you are t

Strany 720

HP Storage Essentials SRM 6.0 User Guide 709set a TNS listener password, the software is not able to discover the Oracle instances serviced by the lis

Strany 721

Troubleshooting710• Unable to Detect a Host Bus Adapter, page 714• Navigation Tab Displays Removed Drives as Disk Drives, page 715• Unable to Obtain I

Strany 722 - Business Tools684

HP Storage Essentials SRM 6.0 User Guide 711Host appears discovered and it is not connected to the switch.The switch was previously made aware of the

Strany 723 - 20 Troubleshooting

HP Storage Essentials SRM 6.0 User Guide 37• HP SIM does not allow blank passwords. Since these switches do not use a password, enter anything for the

Strany 724 - Troubleshooting686

Troubleshooting712*The CIM extension for Microsoft Windows enhances Windows Management Instrumentation (WMI) so that it can gather information from ho

Strany 725

HP Storage Essentials SRM 6.0 User Guide 7138. Enter the host’s WWN in hexadecimal format. Multiple WWNs can be entered as a comma-separated list. For

Strany 726

Troubleshooting714A Discovered Sun StorEdge A5000 JBOD Does Not Display Its WWN ProperlyAlthough full monitoring and management support is available o

Strany 727

HP Storage Essentials SRM 6.0 User Guide 715Navigation Tab Displays Removed Drives as Disk DrivesIf you remove an internal disk from a Solaris host an

Strany 728 - Certificate

Troubleshooting7169. When you are done, click Save.“CIM_ERR_FAILED” MessageIf you are in a McDATA environment where the EFC Manager Service Processor

Strany 729 - Configuring the Java Console

HP Storage Essentials SRM 6.0 User Guide 717the loss of communication, perform Discovery Data Collection to obtain the latest information from the ele

Strany 730

Troubleshooting718Once the connection is working, the provisioning operation should succeed. If it continues to fail because the active zone set infor

Strany 731 - Errors in the Logs

HP Storage Essentials SRM 6.0 User Guide 719still increase the time before the management server times out, but keep in mind that it will lengthen dis

Strany 732 - -port 1234

Troubleshooting720During the recalculation period, you may not be able to log into the application. If you are already logged into the application, na

Strany 733

HP Storage Essentials SRM 6.0 User Guide 721See ”Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries” on page 19 for more informati

Strany 734 - Troubleshooting696

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries38• For switches with SMI-S connections, provide the switch user name. • HP SIM

Strany 735

Troubleshooting722• Known Driver Issues, page 722• Known Device Issues, page 722• “mailbox command 17 failure status FFF7” Message, page 725• ”Process

Strany 736 - Troubleshooting698

HP Storage Essentials SRM 6.0 User Guide 723Table 162 Known Device IssuesDevice Software DescriptionAIX host NA If you are receiving replication error

Strany 737

Troubleshooting724SGI IRIX host CXFS file systemsThe management server can only monitor CXFS file systems from the host generating the input/output. F

Strany 738

HP Storage Essentials SRM 6.0 User Guide 725Solaris host VxVM If you discover a host with any typical SAN disk groups off line, the storage volume pag

Strany 739

Troubleshooting726“mailbox command 17 failure status FFF7” MessageIf one or more of your Microsoft Windows hosts are using an Emulex HBA driver, you m

Strany 740 - Troubleshooting Mode

HP Storage Essentials SRM 6.0 User Guide 727If a provisioning failure has caused the Symmetrix storage system to remain locked, you are alerted to thi

Strany 741 - Applications

Troubleshooting728

Strany 742 - Troubleshooting704

HP Storage Essentials SRM 6.0 User Guide 729GlossaryAaccess point It is the intersection of the IP address and the provider that discovered the IP add

Strany 743

730services such as event notification, remote access, and query processing. The CIM Object Manager also grants access to the CIM Object Manager repos

Strany 744

HP Storage Essentials SRM 6.0 User Guide 731scan files very quickly because of its structure in the database and because it uses a multi-threaded proc

Strany 745 - Duplicate Logs

HP Storage Essentials SRM 6.0 User Guide 39Keep in mind the following:• SMI-S is the default method for discovering McDATA and Connectrix switches. If

Strany 746 - Troubleshooting708

732mapped Mapped is capacity that is accessible by one or more hosts external to the array (aggregated capacity of volumes that are accessible from ho

Strany 747

HP Storage Essentials SRM 6.0 User Guide 733such as disk mirroring, RAID 5, backup/restore, and data migration, as well as being able to incorporate N

Strany 748 - About the Topology

734Instrumentation (WMI) Microsoft created WMI as its implementation of Web-based Enterprise Management (WBEM). For more information about WMI, refer

Strany 749

HP Storage Essentials SRM 6.0 User Guide 735Index3PAR 48AaboutAccess tab 258asset attributes 323Backup Manager toolbar 579Business Tools 675butto

Strany 750 - #hostPortWWNs=

736domain controller 88, 126elements 151, 153e-mail schedule 440event policies 379general information 645geographic information 647host securi

Strany 751

HP Storage Essentials SRM 6.0 User Guide 737resources 588scheduling collectors 198servers 588summary backup charts 575, 587, 592topology 582Bac

Strany 752 - Troubleshooting714

738full name 146logging 192login name 146number of retries 704Oracle Listener Password 243organizations 153password 126, 146phone number 146p

Strany 753

HP Storage Essentials SRM 6.0 User Guide 739cimom.symmetrix.exclude 49CIO role 137CISCO switchestopology 251VSAN 251Cisco switches 35CLARiiON 53

Strany 754 - “CIM_ERR_FAILED” Message

740cumulative licenses 172Current View combo box 357customperiods 400custom commandsabout 293adding 294deleting 296editing 296setting up 265st

Strany 755

HP Storage Essentials SRM 6.0 User Guide 741roles 150storage pool 544storage pools 543TNS Listener Port 126user accounts 146volumes 550, 564zon

Strany 756 - Troubleshooting718

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries40http://www.hp.com/go/hpsim/providers for instructions. Check this web site per

Strany 757 - Recalculating the Topology

742credentials 22discovery groups 76discovery list 77element changes 81elements 21, 27Emulex host bus adapters 703enabling product health monit

Strany 758 - Troubleshooting Provisioning

HP Storage Essentials SRM 6.0 User Guide 743discovery schedule 184e-mail address 146e-mail schedule 443e-mail schedules 206, 669fabric name 265,

Strany 759 - Troubleshooting Hardware

744EMC Symmetrix 49, 536, 564excluding from forced refresh 50Empty Chart message 367Emulex host bus adapters 703errordatabase connection failed

Strany 760 - Known Device Issues

HP Storage Essentials SRM 6.0 User Guide 745host dependency 632LUN dependency 633storage system dependency 632volume dependency 632, 633zone depe

Strany 761

746hierarchyorganizations 137hostnot in topology 709host bus adapterunable to detect 714host bust adaptersreplacing 676host dependencyhost 632hos

Strany 762 - Troubleshooting724

HP Storage Essentials SRM 6.0 User Guide 747Java memory 691increasing memory 691Java plug-in 720installing 13jboss.propertiesmodifying 187jobspro

Strany 763

748Bridge Agent 38changing the discovery settings 43discovering 38excluding from discovery 44managing 45adding 46removing 46replacing 46member

Strany 764 - Symmetrix

HP Storage Essentials SRM 6.0 User Guide 749namingstorage tier 642naming conventionsfor zones 630naming organizations 137NAS devicesdiscovery 63HP

Strany 765

750Volume Creation, LUN Security, and Zone Operation 600, 625volume dependency filter 632, 633zone dependency filter 633Zone Operation 611Path t

Strany 766 - Troubleshooting728

HP Storage Essentials SRM 6.0 User Guide 751drivers 722processexclusive lock 726Processor Utilization 401product health monitoringenabling 25profi

Strany 767 - Glossary

HP Storage Essentials SRM 6.0 User Guide 41NOTE: The user name and password are defined during the SMI-S provider installation. These credentials migh

Strany 768

752schedules 205storage pool 544storage pools 543TNS Listener Port 126user accounts 146volumes 550zone aliases 526zone members 528zone sets 5

Strany 769

HP Storage Essentials SRM 6.0 User Guide 753SSAN xxxv, 732SAN Zoning Overview 518savingchargeback information 641graph 395graphs 394logs 190top

Strany 770

754cache block 569storage pool 543SMI-S devicesdiscovery 20testing SMI-S providers 23SMTP 178, 733SNIA specification 733SNMPauthentication erro

Strany 771

HP Storage Essentials SRM 6.0 User Guide 755Sun NAS devices 66Sun StorEdge A5000 714Sun StorEdge storage systems 61, 623510 626130 626920, 6940

Strany 772

756timesetting 223timeoutHDS 566TNS Listener Portchanging 126tnsnames.ora file 214toolbarBackup Manager 579Capacity Manager 357System Manager 2

Strany 773

HP Storage Essentials SRM 6.0 User Guide 757user profilemodifying 146usersabout 137adding 144first time 5organizations 148roles 147, 148, 149u

Strany 774

758Worldwide Name 734WorldWide Name zoning 733Worldwide Name zoning 734about 734write caching 541Write Operations 401WWN 734XXFS 326Xiotech st

Strany 777

viiiManaging Roles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 148Adding Roles

Strany 778

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries42• User name—Enter the user name for EFC Manager or Connectrix Manager.• Passwo

Strany 779

HP Storage Essentials SRM 6.0 User Guide 43NOTE: The management server uses the Windows SNMP trap service when you run HP SIM and HP Storage Essential

Strany 780

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries44To enable SNMP:a. Uncomment the cimom.useSnmpMcDataProvider property by removi

Strany 781

HP Storage Essentials SRM 6.0 User Guide 45The management server excludes the switches with the following WWNs: 1000080088A07024 and 1000080088A0D0B6I

Strany 782

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries46Adding McDATA and EMC Connectrix SwitchesAfter you add switches to an existing

Strany 783

HP Storage Essentials SRM 6.0 User Guide 474. Click Close to return to the Advanced page.5. Paste the copied text into the Custom Properties box. 6. M

Strany 784

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries48Discovering 3PAR Storage SystemsTo discover a 3PAR storage system, the SMI-S s

Strany 785

HP Storage Essentials SRM 6.0 User Guide 49• Password of the storage system.Discovering EMC Solutions EnablerIf you are using a nethost file, edit it

Strany 786

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries50If the cimom.symmetrix.exclude property is not specified, the management serve

Strany 787

HP Storage Essentials SRM 6.0 User Guide 511. Select Options >Storage Essentials > Manage Product Health > Advanced. 2. Click Show Default Pr

Strany 788

HP Storage Essentials SRM 6.0 User Guide ixCustomizing Properties . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Strany 789

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries52When you use the management server to discover the CLARiiON storage system, pr

Strany 790

HP Storage Essentials SRM 6.0 User Guide 53To obtain information about HDS storage systems, the management server must be able to access the port that

Strany 791

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries543. Copy the following command. #cimom.hds.exclude=61038,610374. Click Close to

Strany 792

HP Storage Essentials SRM 6.0 User Guide 55NOTE: To find the serial number, double-click the storage system in System Manager, and then click the Prop

Strany 793

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries56• Password for accessing the MSA SMI-S provider Discovering HP StorageWorks EV

Strany 794

HP Storage Essentials SRM 6.0 User Guide 57Indications for display in its Event Manager. HP Storage Essentials then forwards the events to HP SIM&apos

Strany 795

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries58Viewing or Changing the Community String in Command View EVA 6.xTo view or cha

Strany 796

HP Storage Essentials SRM 6.0 User Guide 59NOTE: To determine provisioning support for HP StorageWorks Arrays, see Table 135 on page 536 and Table 136

Strany 797

Discovering Switches, Storage Systems, NAS Devices, and Tape Libraries60NOTE: The user name and password must be for a Partition Storage Administrator

Strany 798

HP Storage Essentials SRM 6.0 User Guide 61•For DS devices enter cmd addessserver <ipaddress> <username> <password> where ipaddress

Komentáře k této Příručce

Žádné komentáře